KEGG   Candida tropicalis: CTRG_00414Help
Entry
CTRG_00414        CDS       T01115                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_00414
   00051 Fructose and mannose metabolism
    CTRG_00414
   00052 Galactose metabolism
    CTRG_00414
   00500 Starch and sucrose metabolism
    CTRG_00414
   00520 Amino sugar and nucleotide sugar metabolism
    CTRG_00414
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTRG_00414
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CTRG_00414
Membrane trafficking [BR:ctp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CTRG_00414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 483 aa AA seqDB search
MVHLGPKPAQPRKGTFTDVPSQLLEAIKPFEKEFTISGETLRAIVAHFIKELNRGLSKQG
GNIPMIPGWVMEYPTGKETGNYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPSHMRT
ATKDELWDFIAKCLKQVVDEVFPEGVTQPIPLGFTFSYPASQDRINEGVLQRWTKGWAID
GIEGHDVVPMLQSAVKKVGVPINVVALINDTTGTLVASLYTDPETKMGVIFGTGVNGAYY
DVVGEIPKLEGRCGADIPPTSLMAINCEYGSFDNEHFILPRTKYDIQIDAESPKPGQQTF
EKMNSGYYLGELLRLILLELADEKKLIFKGQNIDKLRKPYVMDTSFPSRIELDPFENLSD
VADIFQDELGIQTTEPERKIIRRLSELIGERSARLSVCGIAAICQKRGYETAHIAADGSV
FNRYPGFKERAAKALRDIYQWPATQKDPIVIVAAEDGSGVGAAIIAALTEKRLKEGKSVG
VIA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcggtccaaaaccagctcaaccaagaaagggtaccttcactgatgtccca
agtcaattgttagaagctatcaaaccatttgaaaaggaatttaccatttctggtgaaact
ttgagagccattgttgcccacttcatcaaagaattgaaccgtggtttgtccaaacaaggt
ggtaacattcctatgattccaggttgggtcatggaatacccaactggtaaagaaaccggt
aactaccttgctatcgatttgggtggtaccaacttgagagttgttttggtcaaattaggt
ggtaacagagatttcgacaccactcaatccaaatttgctttgccatctcacatgagaact
gccactaaagatgaattgtgggatttcattgctaaatgtttgaaacaagttgtcgatgaa
gttttcccagaaggtgtcactcaaccaattccattgggtttcactttcagttatccagcc
tcccaagaccgtatcaacgaaggtgtcttgcaaagatggactaaaggttgggccattgat
ggaattgaaggtcacgatgttgttccaatgttgcaatctgctgttaaaaaggttggtgtt
ccaatcaatgttgttgctttgattaacgataccactggtaccttggttgcttccttatac
actgatccagaaaccaagatgggtgttattttcggtactggtgtcaatggtgcttactac
gatgttgttggtgaaattccaaaattggaaggcagatgtggcgctgatattccaccaact
tcattgatggctatcaactgtgaatacggttctttcgataacgaacactttatcttgcca
agaaccaaatacgatatccaaattgatgctgaatctccaaaaccaggtcaacaaactttt
gaaaagatgaactctggttactacttgggtgaacttttgagattgatcttgttggaattg
gctgatgaaaagaaattgatctttaaaggtcaaaacattgataaattaagaaaaccatat
gttatggatacttctttcccatccagaattgaattggatccattcgaaaacttgtctgat
gttgctgatatcttccaagatgaattgggtatccaaaccactgaaccagaaagaaagatc
atccgtcgtctttctgaattgattggtgaaagatctgccagattatctgtctgtggtatt
gctgctatctgtcaaaagagaggttatgaaaccgcccatattgctgctgacggttctgtc
ttcaacagatacccaggtttcaaggaaagagctgccaaggctttgagagatatctaccaa
tggccagctacccaaaaggacccaattgtcattgttgctgctgaagatggtagtggtgtt
ggtgctgctattattgctgctttgaccgaaaagagattgaaggaaggtaaatctgtcggt
gttattgcttag

DBGET integrated database retrieval system