KEGG   Candida tropicalis: CTRG_03132Help
Entry
CTRG_03132        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00051  Fructose and mannose metabolism
ctp00052  Galactose metabolism
ctp00500  Starch and sucrose metabolism
ctp00520  Amino sugar and nucleotide sugar metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ctp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_03132
   00051 Fructose and mannose metabolism
    CTRG_03132
   00052 Galactose metabolism
    CTRG_03132
   00500 Starch and sucrose metabolism
    CTRG_03132
   00520 Amino sugar and nucleotide sugar metabolism
    CTRG_03132
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTRG_03132
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CTRG_03132
Membrane trafficking [BR:ctp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CTRG_03132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8299760
NCBI-ProteinID: XP_002548835
UniProt: C5MAP0
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MSLPEKLESTLQSLEKEFDITDEYLIKATDYFVEQMDVGLKAPEQSRETIPMIPTYVTKL
PTGKEKGLYLAADLGGTNFRVCSIDLHGDHTYELQQEKFRIPDTLMKGTKSGELFAYLAK
RVQGFLMDHHPETCTAKKSQTIKLGFTFSFPVNQTDIDHGTLIRWTKGFDIPDTVDRDVV
DLFQANLTILEVNVKVVALVNDTTASMIARAYLNDRDESNATTVVGCIFGTGTNGAYYES
IDKISKLKNPPAGADGMLINTEWGSFDNELKILPRTKFDDAVDAETPNPGYHLFEKRISG
RFLGEILRVVLIDLFKQGLIFQDLYKRRGGSLPHRIDQPWLLDSEVLSYLQIDDSTDLKM
SKLILENVLRLETTRDEREVIQRLTRAISKRSAKLAAIALAGVAKRVKDQHKDEKYDLEI
AADGSVVEFYPGFREKVSEVINLINPLKGTDKKVVITISKSGSALGAALAAATA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcccagaaaaattagaatctacccttcaatcactcgagaaagagtttgacatc
accgatgaatacttaatcaaggccactgattattttgttgaacaaatggacgttggtttg
aaggccccagaacaatctagagaaacaattcctatgattccaacttatgtcaccaaattg
ccaaccggtaaagaaaagggtttgtatttggctgctgatttgggtggtaccaacttcaga
gtttgttcaattgatttgcatggtgaccatacttatgaattgcaacaagaaaagtttaga
attcctgacactttgatgaaaggtaccaagtccggtgaattgtttgcttacttggccaaa
agagttcaaggatttttgatggaccaccatccagaaacttgtactgccaagaagtcccaa
acaattaaattgggattcacttttagtttcccagtaaaccaaactgatattgatcatggt
accttgattagatggactaaaggttttgatattcctgatactgttgatcgtgatgtggtt
gatttgttccaagctaatttgaccattttggaagtcaatgtcaaggttgttgctttggtt
aacgataccactgcctcaatgattgccagagcttatcttaatgatagggacgaatctaat
gccaccactgttgttggatgtattttcggtactggtactaacggtgcatattatgaatct
attgataagatttccaaattgaagaatccaccagctggtgctgatggtatgcttatcaat
accgaatggggttcttttgataatgagttgaagattttgccacgcaccaaattcgatgat
gctgttgatgctgaaactcctaaccctggctaccatttatttgaaaagagaatcagtggt
agatttttgggtgaaattttaagagttgttttaattgatttgtttaaacaaggattgatt
ttccaagatttgtacaagagaagaggaggttcattgcctcatagaattgatcaaccatgg
ttgttggactccgaagtcttgtcttaccttcaaattgatgactcgactgatttgaagatg
tctaagttgatcttggagaatgttttgagattggaaactaccagagatgaaagagaagtt
atccaaagacttaccagagctattctgaaacgttctgctaaattggctgctattgctctt
gctggtgttgccaagagagtcaaggatcaacataaagacgaaaaatacgatttagaaatt
gcagctgatggttcagttgttgaattttacccaggtttcagagaaaaagttagtgaagtt
atcaacttgattaatcctttgaaaggaacagataaaaaggtcgttattactatttccaag
ctgggttctgctcttggtgctgccttagctgctgctactgcttag

DBGET integrated database retrieval system