KEGG   Cronobacter turicensis: CTU_29160Help
Entry
CTU_29160         CDS       T00999                                 

Gene name
yfbQ
Definition
(GenBank) Uncharacterized aminotransferase yfbQ
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ctu  Cronobacter turicensis
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTU_29160 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    CTU_29160 (yfbQ)
   00220 Arginine biosynthesis
    CTU_29160 (yfbQ)
Enzymes [BR:ctu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CTU_29160 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     CTU_29160 (yfbQ)
Amino acid related enzymes [BR:ctu01007]
 Aminotransferase (transaminase)
  Class I
   CTU_29160 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3050518..3051732
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARDMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPRIDELDLAINKLGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccatcgaaaaatccagtaagctcgacaatgtctgctacgacatccgcggcccg
gtgctaaaagaggccaaacgcctcgaagaggaaggtcaaaaagttcttaagctgaatatc
ggcaacccggcccctttcggctttgacgcgcctgatgaaattcttgtggatgtcatccgc
aatctgcctaccgcccagggctactgcgattccaaagggctctattccgcccgtaaagct
atcatgcagcactaccaggcgcgcgacatgcgcgacgtcacggttgaggatatttatatc
ggcaatggcgtttctgagcttatcgttcaggcgatgcaggcgttactgaacagtggtgat
gaaatgctggtgccggcgcccgactacccgctgtggacggcggcggtgtcactctccggc
ggcaaagcggtgcactatctttgtgatgaatcctcagactggttcccggatctcgacgac
attcgcgccaaaatcacgccgcgcacccgcggaattgtcattatcaacccgaacaacccg
accggcgcggtctattcgaaagaactgctgctggaaatcgttgagatcgcccgccagcat
aatctgatcattttcgcagacgaaatttacgacaagatcctctatgacgacgcccagcac
cactcgatcgcagcgctggcgccggatctgctcaccgtcacctttaacggcctctccaaa
acgtaccgtgtggcgggcttccgtcagggctggatggtgctgaacgggccgaaaaaacac
gccaaagggtatattgaagggctggaaatgcttgcttcaatgcgcctgtgcgcgaacgtt
cctgcgcagcacgccatccagacggcccttggcggttatcagagcatcagcgaatttatc
gtacccggcgggcggctttacgaacaacgcaaccgcgcgtgggaactgatcaacgaaatc
ccaggcgtcagctgcgtaaaaccgcgcggcgcgctctacatgttcccgaaaatcgacgca
aagcgttttaatattcacgacgatcagaaaatggtgctcgatttcctgctgcaggaaaaa
gtactgctggttcaggggaccgcgtttaactggccgtggcctgaccacgtacgtatcgtg
acgctgccgcgcatcgatgaactcgatctcgccattaacaagctgggccgcttcctttcc
ggctaccatcagtaa

DBGET integrated database retrieval system