KEGG   Cronobacter turicensis: CTU_38520Help
Entry
CTU_38520         CDS       T00999                                 

Gene name
tuf1,tuf2
Definition
(GenBank) Elongation factor Tu
Organism
ctu  Cronobacter turicensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3999889..4001073)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactaccgttctggcgaaaacctat
ggtggttctgctcgtgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgtt
gactgcccgggccacgccgactatgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgctatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgcgagctgctgtctcag
tacgacttcccgggcgacgacacgccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggcaggcttcctggattcctacatc
ccggaaccggagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtgggt
gaagaagttgaaatcgtgggtatcaaagacaccgcgaaatccacctgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggcgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtgctggctaagccgggctccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtaccactgacgtgaccggt
accatcgaactgccggaaggcgttgagatggtaatgccgggcgacaacattaaaatggtt
gtcaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgcgaaggc
ggccgtaccgttggcgcgggcgtggttgctaaagttctgggctaa

DBGET integrated database retrieval system