KEGG   Chlamydia trachomatis G/9301: CTG9301_00285Help
Entry
CTG9301_00285     CDS       T01906                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctv  Chlamydia trachomatis G/9301
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTG9301_00285 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CTG9301_00285 (sucA)
   00380 Tryptophan metabolism
    CTG9301_00285 (sucA)
Enzymes [BR:ctv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTG9301_00285 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
60946..63663
Genome map
AA seq 905 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQVFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSIAVETLNCSPEIQEYIWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGQKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQM
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDILACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNESDDPFVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSDELERIDTEIAH
VLNQEYASLKDPGVERLDKKECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEH
FSPHAKIRSLLNKRMSMADGAIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQ
LVWTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFG
DFSNGAQIIFDQYISSGIQKWDLHSDVIVLLPHGYEGQGPEHSSARIERYLQLASDWNFQ
VVLPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDE
NPNYHAKVLVLCSGKIYYDYRASLPKDLECRFACIRVESLYPLYLEDLLVLISKYTEVHH
YVWLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSTLMETLF
SIGRE
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaggttgggaagacggaggggagcccaacagaatcttctcatgatcaagtctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatcgctgttgag
acattgaattgctctcctgagatccaagaatatatctggaaactcatggaaggagagaag
ccctctttaaccaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggacaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgtcggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagatg
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatattttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaagtgacgatccttttgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccgacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagataaaaaa
gaatgtatgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggataca
tcgttagacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcat
ttttctcctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatgga
gcgatcggttatgattggggaatggctgaagaggtggcgttcgcttctttattacaagaa
ggtttttcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacag
ttagtctggacggatgtccagacaggggatacattctctccattatatcacttgtctccg
agtcaaggcagcgtggaattatacaattcccctctatctgaatacgccgttttaggcttt
gaatatggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttgga
gacttttccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaa
tgggatttacattccgatgtaattgtactgcttcctcatggctatgaggggcaaggacct
gagcattcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaa
gttgttcttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagaga
gacctctctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgc
gtgagttctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgag
aatcctaactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactat
cgtgcttctcttcctaaagatcttgaatgtcgttttgcttgtatacgagtagagagtttg
tatccgttatacttagaagatctattggttctgataagcaaatatacggaagttcaccat
tatgtatggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagca
actgacgagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacg
gcaacaggatctgcgagtttaagtcaaaaagaattatcgacgttaatggaaaccttgttt
tctataggtagagagtag

DBGET integrated database retrieval system