KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_0319Help
Entry
Clo1313_0319      CDS       T01933                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Brite
Translation factors [BR:ctx03012]
 Eukaryotic Type
  Elongation factors
   Clo1313_0319
 Prokaryotic Type
   Clo1313_0319
Mitochondrial biogenesis [BR:ctx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Clo1313_0319
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Clo1313_0319
  Exosomal proteins of breast cancer cells
   Clo1313_0319
  Exosomal proteins of colorectal cancer cells
   Clo1313_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
350435..351637
Genome map
AA seq 400 aa AA seqDB search
MSKAKFERTKPHVNIGTIGHVDHGKTSLTAAITKVLGFQGKANYTSYENIDKAPEERERG
ITISTSHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEIRELLNTYEFPGDEIPIIRGSALAALE
STATSVDAPEYQPILKLMEEVDKYIPTPQRDSDKPFAMPVEDVFTITGRGTVATGRVERG
TLKMGDEVEIVGLSDSPKKTVVTGIEMFRKLLDQAVAGDNIGALLRGIQRNEVERGQVLA
KPGSIKPHTYFEAQVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGVVELPQGTEMVMPG
DHITMKVKLITPVAMEEGLKFAIREGGRTVGAGNVSKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagctaaatttgaaagaacaaaaccccacgttaatatcggaacgattggtcac
gttgaccatggtaagacatcattgactgcggctataacaaaagttttaggtttccagggt
aaggcaaactatacttcttatgaaaacatcgacaaagctccggaagaaagagaaagaggt
attacaatatcaacttcacacgttgagtatgaaactgataacagacactatgctcacgtt
gactgccctggtcatgccgactacgttaagaacatgatcacaggtgctgctcagatggac
ggtgctatacttgttgtatcagcagcagacggtccgatgccacagacaagagaacacatt
ttgttggctcgtcaggttggtgtgccatacatagttgttttcttgaacaagtgtgatatg
gtagatgacgaggaacttctcgaattggttgaaatggaaatcagagaactcctgaatact
tacgaattccccggagacgaaattccgataataagaggttcagcacttgctgctcttgaa
tcaacagctacttcagttgacgctccggaatatcaaccgattttgaaactcatggaggaa
gttgacaaatatattccgactcctcagagagatagtgacaaaccgtttgctatgcctgtt
gaagacgtattcacaattacaggtcgtggtactgttgctacaggtagagttgaaagagga
actcttaagatgggtgacgaagttgaaattgttggtttgtctgattctccgaagaaaaca
gttgtcaccggtatagaaatgttcagaaagcttcttgatcaggctgttgctggtgacaat
ataggagctctcctgagaggtattcagagaaatgaggtagaaagaggacaggttcttgca
aaacccggttcaatcaaacctcacacttattttgaagcacaggtttacgttttgacaaaa
gaagaaggtggaagacatactcctttcttcaacaactacagacctcagttctatttcaga
actactgacgttacaggagtagttgagcttcctcagggaactgaaatggttatgcccggt
gaccacataaccatgaaagtcaaattgataactcctgtagctatggaagaaggattgaag
ttcgctatccgtgaaggtggtagaactgtaggagcaggaaacgtatccaagataattgaa
taa

DBGET integrated database retrieval system