KEGG   Curtobacterium sp. BH-2-1-1: BJK06_08650Help
Entry
BJK06_08650       CDS       T04562                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00020  Citrate cycle (TCA cycle)
cub00480  Glutathione metabolism
cub01100  Metabolic pathways
cub01110  Biosynthesis of secondary metabolites
cub01120  Microbial metabolism in diverse environments
cub01130  Biosynthesis of antibiotics
cub01200  Carbon metabolism
cub01210  2-Oxocarboxylic acid metabolism
cub01230  Biosynthesis of amino acids
Module
cub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cub_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cub00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJK06_08650
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJK06_08650
Enzymes [BR:cub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BJK06_08650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AOX65813
LinkDB All DBs
Position
1823250..1825460
Genome map
AA seq 736 aa AA seqDB search
MAKIIYTLTDEAPFLATHSFLPVIQAFAGTAGVDVETRDISLSGRIIAQFPERLTAEQRL
DDALAELGDLAKTPEANIIKLPNISASIPQLKAAIKELQAQGYDLPDYPDEPTTDDERDA
RARYDRTKGSAVNPVLREGNSDRRAPLSVKNYARKHPHRMGAWSHDSKTNVVTMGTDDFR
SNEQSWIAPADDVLTIEFVGADGATTVLKQSIPVLAGEVVDGTVLHVRALEAFLQDQIRA
AQEQGILFSVHLKATMMKVSDPIIFGHVIRAFFPSVFERFGADLAAAGLNPNDGLGSILA
GLDAVPNGAEIKQAFADGIDAGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGHMW
GPDGEEHDTLAVIPDSSYAGIYQATIEDCRANGAFDPATMGSVPNVGLMAQKAEEYGSHD
KTFEVPAAGRVRVVTSGGETVIEHEVEAGDIWRACQTKDVAIRDWVKLAVTRARATGSPA
VFWLDETRAHDANLIGLVRTYLAEQDTDGLQIEILSPEDAMRFSLERIRRGEDTISVTGN
VLRDYLTDLFPIMELGTSAKMLSVVPLLGGGGLFETGAGGSAPKHVQQLVEQNYLRWDSL
GEFLALAVSLEHLAGVTGNERAKILGETLDRATGTFLDEDKSPGRKLGSIDNRGSHFYLA
KYWAQELAAQTTDAQLASAFAEIAATLDEQESTIVEELNSVQGHPADIGGYYRPDDAKTS
AVMRPSATLNGILAAL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcatctacaccctcacggacgaggcgccgttcctcgccacccactccttc
ctcccggtcatccaggccttcgccggcaccgcaggtgtcgacgtcgagacccgcgacatc
tcgctctcgggccggatcatcgcccagttcccggagcggctcaccgccgaacagcgcctg
gacgacgccctcgccgagctcggggacctcgcgaagacccccgaggcgaacatcatcaag
ctgccgaacatctcggcgtcgatcccgcagctcaaggccgcgatcaaggagctccaggcg
cagggctacgacctgccggactaccccgacgagccgacgaccgacgacgagcgcgacgcc
cgcgcccgctacgaccgcaccaagggcagcgccgtgaacccggtcctgcgcgagggcaac
tccgaccgccgcgcgccgctctccgtcaagaactacgcccgcaagcacccgcaccgcatg
ggcgcctggagccacgactcgaagacgaacgtcgtgacgatgggcacggacgacttccgc
tcgaacgagcagtcctggatcgcgcccgccgacgacgtcctgacgatcgagttcgtcggt
gccgacggtgcgaccacggtcctcaagcagtcgatccccgtcctcgcgggcgaggtcgtc
gacggcacggtgctgcacgtccgggcgctcgaggccttcctgcaggaccagatccgcgcg
gcgcaggagcagggcatcctgttctcggtgcacctcaaggccacgatgatgaaggtctcc
gacccgatcatcttcggccacgtcatccgtgcgttcttcccgagcgtcttcgagcgcttc
ggcgccgacctcgccgccgccgggctcaacccgaacgacggcctcggctcgatcctcgcc
gggctcgacgccgtcccgaacggtgcggagatcaagcaggcgttcgcggacggcatcgac
gcgggccccgagctcgcgatggtcgactccgacaagggcatcacgaacctgcacgtcccg
agcgacgtcatcgtggacgcctccatgcccgcgatgatccgcacctccggccacatgtgg
ggtccggacggcgaggagcacgacaccctcgcggtcatcccggactcgagctacgccggc
atctaccaggccacgatcgaggactgccgcgccaacggtgcgttcgacccggccaccatg
ggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcgcacgac
aagaccttcgaggtcccggcagccggccgcgtccgcgtggtcacgagcggcggcgagacg
gtcatcgagcacgaggtcgaggccggtgacatctggcgcgcctgccagaccaaggacgtc
gcgatccgcgactgggtgaagctcgccgtgacgcgtgcccgtgcgaccggttcccccgcg
gtgttctggctcgacgagacccgtgcgcacgacgcgaacctcatcggcctggtgcggacc
tacctcgccgagcaggacaccgacgggctgcagatcgagatcctctcccccgaggacgcg
atgcgcttctcgctcgagcgcatccgccgcggcgaggacaccatctccgtcacgggcaac
gtgctccgcgactacctcaccgacctgttcccgatcatggagctcggcacctcggcgaag
atgctctccgtcgtcccgctcctcggcggcggcggcctgttcgagaccggtgccggtggt
tcggcgccgaagcacgtgcagcagctcgtcgagcagaactacctgcgctgggacagcctc
ggcgagttcctcgccctcgcggtcagcctcgagcacctcgccggtgtgacgggcaacgag
cgggcgaagatcctcggcgagacgctcgaccgtgcgaccggcacgttcctcgacgaggac
aagtcgccggggcgcaagctcgggtcgatcgacaaccgcggcagccacttctacctggcg
aagtactgggcccaggagctcgcggcgcagacgaccgacgcccagctcgcctcggcgttc
gccgagatcgccgcgacgctcgacgagcaggagtcgacgatcgtcgaggagctgaacagc
gtgcaggggcacccggcggacatcggcgggtactaccgtccggacgacgccaagacgagc
gccgtgatgcgcccgtccgccacgttgaacgggatcctcgccgcgctgtag

DBGET integrated database retrieval system