KEGG   Curtobacterium sp. BH-2-1-1: BJK06_16905Help
Entry
BJK06_16905       CDS       T04562                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJK06_16905
  Lipid metabolism
   00071 Fatty acid degradation
    BJK06_16905
  Amino acid metabolism
   00350 Tyrosine metabolism
    BJK06_16905
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJK06_16905
   00626 Naphthalene degradation
    BJK06_16905
Enzymes [BR:cub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BJK06_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3561041..3562105)
Genome map
AA seq 354 aa AA seqDB search
MQAAVVHAFGQPLIVDERPLPDPGPGQVLVRIEASGLCHTDIHAAHGDWPVRPTPPFVPG
HEGVGIVEAVGPDVTERRVGERVALPWLGHACGACRYCIDGRETLCEQQQNTGYSIDGAF
AQFAVADAEYAVPVPAGVDPWDAAPLTCAGVTTYKALKVAHVVPAETVAVFGVGGLGHLA
VQYARVFGADVIGVDVEPEKLRLARDLGADHTVDASSGDAAAQVQELGGADVAVVLAASA
AVFEQAFASLKRGGRLVCVALPADGTMSVPIFDTVLKGISIIGSIVGTRQDLAEVFALHA
AGRTRVVSVRRPLADVNDAMADVLAGRVPARIVFELPAVEREAVVLGPDERVGR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcagtcgtccacgcattcggacagcccctcatcgtcgacgaacgaccactc
ccggatcccggccccgggcaggtgctcgtccggatcgaggcgtcggggctctgtcacacc
gacatccacgcagcgcacggcgactggcccgtccgcccgaccccgccgttcgtccccgga
cacgagggcgtcggcatagtcgaggcggtcgggcccgacgtcaccgagcggcgcgtcggc
gaacgggtcgcactcccctggctggggcacgcgtgcggcgcctgccgctactgcatcgac
ggccgcgagacgctgtgcgagcagcagcagaacacgggttactcgatcgacggcgccttc
gcccagttcgcggtggcggacgcggagtacgcggtaccggtgcccgccggggtcgacccg
tgggacgcggcaccgctcacctgcgccggcgtgaccacgtacaaggccctcaaggtcgcc
cacgtcgtacccgccgagaccgtggccgtcttcggcgtcggcggcctcggacacctcgct
gtgcagtacgcccgagtcttcggtgccgacgtgatcggggtcgacgtcgagcccgagaag
ctccgactcgcgcgggacctcggtgccgaccacaccgtcgatgcatcgtccggcgacgcc
gcggcgcaggtgcaggagctcggcggcgccgacgtcgccgtcgtcctggccgcgtccgcc
gcggtgttcgagcaggccttcgcgtcgctgaagcgcggcggtcgactcgtctgtgtggcg
ctgccggcggacgggacgatgtccgtcccgatcttcgacaccgtcctcaagggcatctcg
atcatcgggtcgatcgtcggcacgcggcaggacctcgccgaggtgttcgcactgcacgcg
gccggtcgaacccgtgtcgtctccgtccgtcgtccgctggccgacgtgaacgacgcgatg
gcggacgtcctcgcgggacgtgtgccggcgcgcatcgtgttcgagttgcccgccgtcgaa
cgcgaggccgtcgtgctcggaccggacgagcgggtcgggcgatga

DBGET integrated database retrieval system