KEGG   Corynebacterium ulcerans 809: CULC809_00504Help
Entry
CULC809_00504     CDS       T01880                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00020  Citrate cycle (TCA cycle)
cuc00480  Glutathione metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01200  Carbon metabolism
cuc01210  2-Oxocarboxylic acid metabolism
cuc01230  Biosynthesis of amino acids
Module
cuc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC809_00504 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CULC809_00504 (icd)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CULC809_00504 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CAMP_factor
Motif
Other DBs
NCBI-ProteinID: AEG81044
LinkDB All DBs
Position
complement(545426..547636)
Genome map
AA seq 736 aa AA seqDB search
MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGRILSQFPEFLAEDQKV
DDALAELGDLAKTPEANIIKLPNISASVPQLKAAVAELQSQGYKLPDYPDSPSTDEEKDI
RTRYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKHPHRMGAWSADSKTNVVTMESDDFR
HNEKSVIMPSDDTLTIKLVTDNGEKVLKEGLKVLKGEVVDGTFISARALDEFLAVQVKRA
KDEGVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFATYGEQLEAAGLNGENGLAAIYSG
LESLPNGAEIKAAFDAALESGADIAMVNSAKGITNLHVPSDVIIDASMPAMIRTSGHMWN
KNDEEQDTLAVIPDSSYAGVYQTVIADCKKNGAFDPTTMGTVPNVGLMAQKAEEYGSHDK
TFKIEANGTVQVVSSAGEVLIEHNVEAGDIWRACQAKDAPIQDWVKLAVTRSRLSGMPAV
FWLDPERAHDRNLTTLVEKYLADHDTEGLDIRIMSPVDATQFSIDRIRRGEDTISVTGNV
LRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENHLRWDSLG
EFLALAESLRHFANTEGNTKAGVLADALDRATETLLNEGYSPSRKAGEIDNRGSHFFLTK
FWAKELSIQSEDADLAATFAPVAEALEAHSDEIADALLAVQGTPADLGGYYQPDDAKTTA
IMRPVASYNNIISSIK
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcatctacactcgcaccgacgaagcaccgcttctcgccacttactctctc
aagcccgtcgttgaggccttcgcctccaccgcaggcattgaggtggagacccgcgacatc
tccctcgcaggccgcatcctctcgcaattccccgaattccttgcggaggaccaaaaggtc
gacgacgcactggcggaactcggcgatcttgccaaaactccggaagcaaacatcatcaag
cttcctaacatctctgcctcagtccctcagctcaaagctgcggttgcagagctgcagtcc
caaggctacaaacttccggattacccagattctccctccactgacgaggaaaaagacatc
cgcacccgctacgacgcagtcaaaggctcggccgtcaacccagtgctccgcgagggcaac
tccgatcgtcgcgcacctatcgcagtgaagaactttgccaagaagcaccctcaccgcatg
ggtgcatggtcggcagactccaagaccaacgtggtcaccatggaaagcgacgacttccgc
cataacgagaagtccgtcatcatgccttccgacgacaccctcaccattaaattggtgacc
gacaacggtgaaaaggttctcaaagaaggacttaaggtcctcaaaggcgaggtcgtagac
ggcaccttcatctctgcccgcgccctcgacgagttcctagcagtgcaggtcaagcgcgcc
aaagatgaaggcgtcctcttctcggcacacctcaaggccaccatgatgaaggtttccgac
cccatcatcttcggccatgtcgtccgcgcctactttgcagacgtgttcgcaacctacggc
gagcagctagaggcagccgggctcaatggcgagaacggccttgccgcgatttactctggt
ttagagtctctccccaatggcgccgagatcaaagcagctttcgatgcagccctcgaatcg
ggtgccgacatcgccatggtcaactccgccaagggcatcactaacctccatgtcccctcc
gacgtcatcattgatgcctccatgccggctatgatccgaacctctggccacatgtggaac
aagaacgatgaagagcaggacaccctggccgtcatccccgattcctcctacgcaggcgtg
taccaaaccgttatcgcagactgcaagaagaacggcgcattcgatccaaccaccatgggc
accgtccccaacgtgggcctgatggcacaaaaagctgaggaatacggctcacacgataag
actttcaagatcgaagctaacggcaccgtacaggttgttagctccgctggcgaagtcctg
attgagcacaacgtagaggccggcgacatttggcgcgcctgccaggccaaggatgcccct
atccaggactgggttaagctggcagttactcgttcacgcttgtccggtatgcccgcagta
ttctggctcgatcctgagcgcgcgcacgaccgcaacctcacgactctcgtggaaaagtat
ctcgccgaccacgacaccgagggactcgacatccgcatcatgagccctgtcgacgccacc
cagttctccatcgaccgcatccgccgcggcgaggacaccatttcagttaccggaaacgtg
ctccgcgactacaacacggatctcttcccaatccttgagctcggcacctccgcaaagatg
ctctccgtggttcctctcatggctggcggcggactctttgagacaggcgccggcggatcc
gctccaaagcatgtccaacaacttgtcgaggaaaaccacctccgctgggattcccttggc
gagttcctcgctctagcggagtccctacgccactttgccaataccgaaggcaacaccaag
gccggggtacttgccgatgccctcgaccgcgccaccgaaaccctcctcaacgagggttac
tctccatcgcgcaaagcaggagaaatcgacaaccgcggctcgcacttcttccttaccaag
ttctgggcgaaggaattgtcgattcagtccgaagacgccgaccttgccgccacattcgca
cctgtcgcagaggccttggaggcgcactcggatgaaatcgccgatgcactgctcgcagtt
caaggcacccctgccgatcttggtggctactaccagcccgatgacgccaagaccaccgcg
atcatgcgtcccgtcgctagctacaacaacatcattagttccataaagtag

DBGET integrated database retrieval system