KEGG   Cupriavidus sp. NH9: BJN34_34490Help
Entry
BJN34_34490       CDS       T05121                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cuh  Cupriavidus sp. NH9
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cuh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJN34_34490
   00650 Butanoate metabolism
    BJN34_34490
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJN34_34490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJN34_34490
Enzymes [BR:cuh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BJN34_34490
Amino acid related enzymes [BR:cuh01007]
 Aminotransferase (transaminase)
  Class III
   BJN34_34490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(3235885..3237168)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAERAENAELWDVEGRRFIDFAAGIAVVNTGHRHPR
LVKAVADQLDRFTHTAYQIVPYASYVELAEKINARAPGDFAKKTAFFTTGAEAVENAIKI
ARAFTGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLGFGPFPGEVFHAPYPNPLHGVTTA
ESLRAVEALFKTDIDPKRVAAMIFEPVQGEGGFYAAPADFVRGLRKLCNEHGILLIADEV
QTGFARTGKLFAMQHHDVVPDLTTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEEALCERATMLGDKLKAKLIALQDDIPQIADVRGPGAMVALEFCK
AGTNEPDAEMTKRVQARALERGLLLLVCGVYANVIRFLFPLTIPDAVFDEAIGILDEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgctgatctgcaagcgcgcaagaacgccgctaccccgcgcggcgttggcgtc
atgtgcgatttctacgccgagcgcgcggagaacgctgaactgtgggatgtcgagggccgc
cgtttcatcgatttcgcagcaggtatcgcggtggtgaacacgggccatcgccatcccagg
ctggtgaaggcggtggccgaccagctggaccgcttcacccataccgcctaccagatcgtg
ccctatgcctcttacgtggaactggccgaaaagatcaatgcgcgcgcgccgggcgacttc
gcgaagaagaccgccttcttcacgactggcgcggaggctgtcgagaacgccatcaagatc
gcccgcgcattcaccggccggccgggcgtgattgccttctccggcggctttcatggccgt
acgatgatgggcatggcgctgaccggcaaggtggcgccgtacaagcttggcttcggcccg
tttccgggcgaagtgttccacgcgccgtacccgaatccgctgcacggcgtgacgacggcc
gaatcgctgcgcgcggtcgaggcgctcttcaagaccgacatcgatccgaagcgcgtcgcc
gcgatgattttcgagccggtgcagggcgaaggcggcttctacgcggcgcctgccgatttc
gtgcgcgggctgcgcaagctgtgcaacgagcacggcattctgctgattgccgacgaagtg
cagaccggctttgcgcgtaccggcaagctgtttgcgatgcagcaccatgacgtggtgccc
gacctgaccacgatggcgaagagcctggcaggcggcatgccgttgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggcggcgcccggcggcctgggcggcacgtatgccggcaat
ccgctcgccgtggcggcggcgcacgcggtgctggacatcattgacgaggaggcgctgtgc
gaacgcgcaaccatgctcggcgacaagctcaaggcgaagctcatcgcgctgcaggatgac
ataccccagatcgccgatgtgcgcggccctggcgcgatggtcgccttggagttctgcaag
gcgggcacgaacgagccggatgccgaaatgacgaagcgcgtgcaggcgcgcgcgctggag
cgcggcctgttgctgctggtgtgcggcgtgtacgcgaacgtcattcgcttcctgtttccg
ctgacgattcccgacgccgtgttcgacgaagccatcggcattctggatgaggtgctgaag
gaaacggtgggcgtgccagcctga

DBGET integrated database retrieval system