KEGG   Corynebacterium ulcerans 131002: CUL131002_0438Help
Entry
CUL131002_0438    CDS       T03899                                 

Gene name
nanH
Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cuj  Corynebacterium ulcerans 131002
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cuj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CUL131002_0438 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CUL131002_0438 (nanH)
Enzymes [BR:cuj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CUL131002_0438 (nanH)
Bacterial toxins [BR:cuj02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CUL131002_0438 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
443388..445508
Genome map
AA seq 706 aa AA seqDB search
MCWLSHFCVFHPSQGRKFPMTDSRRRGTRKALITLTAALALTAQGLTVPTTFAEEAPSPA
TAPLDNNGLFDAAPPAPVARGAVGEGQLPEPNENPVFDVKMLRDVDPAGQRCFRIPAIAT
AADGTLLVAFDNRYAGEGAKTWCRDAPYDNKKHNSREKQTDIEIYRSSDSGETFETGNFI
AKGTEDPRDLSYTDPAIVVDRETEKIFAFFVRGYDYRFFDALAGVNSEDPDAEIKRRDVQ
DTVVIESNDNGLTWGNLRVISGLTETLQVKSRPGEAVPGHGRFVTSGAGIQLAYGPKAGR
LLVPISVKTMRGRENRVVNLSIYSDDHGETWHSGVGVAGDGTFNGDESKLVELSDGRIMM
NSKDNNQTRWTAYSLDQGETWSDPVRTVVAPPQFPTKHNTGINVSLIRAYPNAPEGSAAA
RVLLYSAPIDKRTNHEHTKDGRNNGWVMASCDDGRSWTHGRQIESSRFQYSVMTPMADGN
IGMVYETGTFDTGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAVEDAKAATAKA
EEATANVVRLTKELEDLEIDREELLEALDKAKAAAQKAITAAEEANAKVKAAEEATAKAE
ESAAKAEDEAKALAEQLAKVEEELAKSQDQAKVLAEAKEAAEIAQKAAEEALRLEKEKNK
TGKDADNTENKGFWQGLLQVLPGLAPIFSFLASLWDGIQKLFGGKA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtgttggctgtctcatttttgtgtgtttcatccatctcaaggaaggaagtttccaatg
acggattcacgccgccgtggaactcgcaaagcgctgataaccctcacggcagcgcttgct
ctcactgctcaaggccttacggtccctacgacttttgccgaagaagcccccagccccgca
actgctcccctcgataacaatgggcttttcgacgccgctccgcccgcacctgtagcgcgt
ggcgcagtaggggaggggcagcttcctgaaccaaatgagaatccggtctttgacgtaaag
atgctgcgggatgtggatccggctggccagcggtgtttccgtattccggctatcgctacg
gctgccgatggaacacttttggtggcttttgataatcggtatgcaggggaaggggcgaaa
acttggtgccgagacgctccatatgacaataaaaagcataattcacgtgagaagcagacc
gatattgagatttatcgttcctctgactctggtgagacttttgaaaccggcaactttatt
gctaaagggacagaagatccacgagacctttcttataccgatcctgcaatcgttgtagat
cgtgagacagagaagatttttgcgttctttgtgagaggctacgattatcgtttctttgac
gcactagcaggcgtgaattctgaagatcctgatgctgaaattaagcgtcgggatgttcag
gatacggttgtgattgagtctaatgataacggtttgacgtgggggaatcttcgtgtcatc
agtggtttgacggagacactacaagttaagtcgcgccctggtgaagctgttccgggtcac
ggtaggtttgttacttctggtgccggtattcagctggcgtatggtcctaaagctggtcgg
cttcttgttccgatatcggtaaaaactatgcggggacgtgaaaatcgtgtcgtaaacctg
tccatttattccgatgatcacggtgagacttggcactctggtgtgggcgtcgcaggcgat
ggaaccttcaacggtgatgagagcaagctcgttgagctatcggacggccgcatcatgatg
aattcgaaggacaataatcaaacacgctggaccgcttattcattagaccagggagaaacc
tggtctgacccggtacgtactgttgttgcccctccgcagtttcccaccaaacacaacacg
ggcattaatgtttccctgatcagggcatatcctaatgctcccgaggggagtgctgcggcc
cgcgtgctcttgtattctgctcctattgataaacgcacgaatcatgaacacacgaaagat
gggcgcaataacggctgggtcatggcctcgtgtgacgatggtaggtcgtggacgcatggg
cgccagatcgaatctagtcgtttccaatattcggtcatgactcccatggccgacgggaat
atcggcatggtttatgagacgggaacatttgacaccggcatgaccctcaagttcgccaag
ttcaacatggcgtggctgggcgctgattgcttgagtaataaggccctgggtatcactgat
ctgccggatcccgctttggccaaggccgttgaagatgcgaaagctgcgacggctaaggct
gaggaggctacggcgaacgtcgtaaggctaacaaaggagctagaggatcttgagattgat
agggaagaactgctagaagctctggacaaggctaaggcagcggcacagaaagccattact
gctgcggaagaagctaatgccaaggttaaggccgctgaggaggctacggcgaaagcggaa
gaatccgctgcaaaggcagaggatgaagctaaggcgcttgcagaacaattggccaaggtt
gaggaggaattagcaaaatcacaagatcaggcaaaggttctcgctgaggctaaagaggct
gccgagattgctcaaaaagcagcagaagaggcgcttaggttggagaaagagaagaacaaa
acaggtaaagacgcagataacaccgaaaataaaggtttttggcaaggtcttttgcaagtc
ttgccaggacttgcccccattttcagtttcttagcatcgctatgggatgggatacagaaa
ttatttgggggtaaagcctaa

DBGET integrated database retrieval system