KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00510Help
Entry
CULC22_00510      CDS       T01549                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cul00001]
   00020 Citrate cycle (TCA cycle)
    CULC22_00510 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CULC22_00510 (icd)
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CULC22_00510 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(545201..547411)
Genome map
AA seq 736 aa AA seqDB search
MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGRILSQFPEFLAEDQKV
DDALAELGDLAKTPEANIIKLPNISASVPQLKAAVAELQSQGYKLPDYPDSPSTDEEKDI
RTRYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKHPHRMGAWSADSKTNVVTMESNDFR
HNEKSVIMPSDDTLTIKLVTDNGEKVLKEGLKVLKGEVVDGTFISARALDEFLAVQVKRA
KDEGVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFATYGEQLEAAGLNGENGLAAIYSG
LESLPNGAEIKAAFDAALESGADIAMVNSAKGITNLHVPSDVIIDASMPAMIRTSGHMWN
KNDEEQDTLAVIPDSSYAGVYQTVIADCKKNGAFDPTTMGTVPNVGLMAQKAEEYGSHDK
TFKIEANGTVQVVNSAGEVLIEHNVEAGDIWRACQAKDAPIQDWVKLAVTRSRLSGMPAV
FWLDPERAHDRNLTTLVEKYLADHDTEGLDIRIMSPVDATQFSIDRIRRGEDTISVTGNV
LRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENHLRWDSLG
EFLALAESLRHFANTEGNTKAGVLADALDRATETLLNEGYSPSRKAGEIDNRGSHFFLTK
FWAKELSIQSEDADLAATFAPVAEALEAHSDEIADALLAVQGTPADLGGYYQPDDAKTTA
IMRPVASYNNIISSIK
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcatctacactcgcaccgacgaagcaccgcttctcgccacttactctctc
aagcccgtcgttgaggccttcgcctccaccgcaggcattgaggtggagacccgcgacatc
tccctcgcaggccgcatcctctcgcaattccccgaattccttgcggaggaccaaaaggtc
gacgacgcactggcggaactcggcgatcttgccaaaactccggaagcaaacatcatcaag
cttcctaacatctctgcttccgtccctcagctcaaagccgcggttgcagagctgcagtcc
caaggctacaaacttccggattacccagattctccctccactgacgaggaaaaagacatc
cgcacccgctacgacgcagtcaaaggctcggccgtcaacccagtgctccgcgagggcaac
tccgatcgtcgcgcccctatcgccgtgaagaactttgccaagaagcaccctcaccgcatg
ggtgcatggtctgcagattccaagaccaacgtggtcaccatggaaagcaatgacttccgc
cataacgagaagtccgtcatcatgccttccgacgacaccctcaccattaaattggtaacc
gacaacggtgaaaaagttctcaaagaaggacttaaggtcctcaaaggcgaggtcgtagac
ggcaccttcatctctgcccgcgccctcgacgagttcctagcagtgcaggtcaagcgcgcc
aaagatgaaggcgtcctcttctcggcacacctcaaggccaccatgatgaaggtttccgac
cccatcatcttcggccatgtcgtccgcgcctactttgcagacgtgttcgcaacctacggc
gagcagctagaggcagccgggctcaatggcgagaacggccttgccgcgatttactctggt
ttagagtctctccccaatggcgccgagatcaaagcagctttcgatgcagccctcgaatcg
ggtgccgacatcgccatggtcaactccgccaagggcatcactaacctccatgtcccctcc
gacgtcatcattgatgcctccatgccggctatgatccgaacctctggccacatgtggaac
aagaacgatgaagagcaggacaccctggccgtcatccccgattcctcctacgcaggcgtg
taccaaaccgttatcgcagactgcaagaagaacggcgcattcgatccaaccaccatgggc
accgtccccaacgtgggcctgatggcacaaaaagctgaggaatacggctcacacgataag
actttcaagatcgaagctaacggcaccgtacaggttgttaactccgctggtgaagtcctg
attgagcacaacgtagaggccggcgacatttggcgcgcctgccaggccaaggatgcccct
atccaggactgggttaagctggcagttactcgttcacgcttgtccggtatgcccgcagta
ttctggctcgatcctgagcgcgcgcacgaccgcaacctcacgactctcgtggaaaagtat
ctcgccgaccacgacaccgagggactcgacatccgcatcatgagccctgtcgacgccacc
cagttctccatcgaccgcatccgccgtggcgaggacaccatttcagttaccggaaacgtg
ctccgcgactacaacacggatctcttcccaatccttgagctcggcacctccgccaagatg
ctctccgtggttcctctcatggctggcggcggactctttgagacaggcgccggcggatcc
gctccaaagcatgtccaacaacttgtcgaggaaaaccacctccgctgggattcccttggc
gagttcctcgctctagcggagtccctacgccactttgccaataccgaaggcaacaccaag
gccggggtacttgccgatgccctcgaccgcgccaccgaaaccctcctcaacgagggttac
tctccatcgcgcaaagcaggagaaatcgacaaccgcggctcgcacttcttccttaccaag
ttctgggcgaaggaattgtcgattcagtccgaagacgccgaccttgccgccacattcgca
cctgtcgcagaggccttggaggcgcactcggatgaaatcgccgatgcactgctcgcagtt
caaggcacccctgccgatcttggtggctactaccagcccgatgacgccaagaccaccgcg
atcatgcgtcccgtcgctagctacaacaacatcattagttccataaagtag

DBGET integrated database retrieval system