KEGG   Curtobacterium sp. MR_MD2014: NI26_00535Help
Entry
NI26_00535        CDS       T04180                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00010  Glycolysis / Gluconeogenesis
cum00030  Pentose phosphate pathway
cum00051  Fructose and mannose metabolism
cum00052  Galactose metabolism
cum00680  Methane metabolism
cum01100  Metabolic pathways
cum01110  Biosynthesis of secondary metabolites
cum01120  Microbial metabolism in diverse environments
cum01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NI26_00535
   00030 Pentose phosphate pathway
    NI26_00535
   00051 Fructose and mannose metabolism
    NI26_00535
   00052 Galactose metabolism
    NI26_00535
  Energy metabolism
   00680 Methane metabolism
    NI26_00535
Enzymes [BR:cum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NI26_00535
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NI26_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AIV39135
UniProt: A0A0N6W6L4
LinkDB All DBs
Position
complement(107451..108479)
Genome map
AA seq 342 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRAIVLKGIAIHGHEFVGFRDGWRGVVDGDIVPLGRKDIQGI
AKQGGTILGTSRTNPFEGPNGGVENITKTLGRHGIDAIVAIGGEGTLAAAKRLTDAGLRI
VGVPKTVDNDLGATDYTFGFDTAVAIATEAMDRLRTTGESHSRCMVAEVMGRHVGWIALH
SGMAAGAHAILIPEQKTSMEQIAAWVRAAYDRGRAPLVVVAEGFVPDHEDNAHTERGLDA
FGRPRLGGIGERLAPMIEEMTGIETRATTLGHIQRGGTPTAYDRVLSTRLGLAAIDSVVE
GRWGRMVALQGTEIVHVSFEDALGELKTVPQARYDEAAIMFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggcatcctcacctccggaggcgactgccccggcctcaacgcggtcatccgc
gccatcgtgctcaagggcatcgcgatccacggccacgagttcgtcgggttccgcgacggc
tggcggggcgtcgtcgacggggacatcgtgcccctcggtcgcaaggacatccagggcatc
gccaagcagggcggcacgatcctcggaaccagccgcacgaaccccttcgaggggccgaac
ggcggcgtcgagaacatcacgaagaccctcggacggcacggcatcgacgccatcgtggcg
atcggcggcgagggcaccctggccgcggcgaagcgcctcaccgacgccggcctgcggatc
gtcggcgtcccgaagaccgtcgacaacgacctcggtgccaccgactacacgttcggcttc
gacaccgccgtcgccatcgcgaccgaggccatggaccgcctccgcaccacgggcgagtcc
cactcgcgctgcatggtcgccgaggtcatgggccggcacgtgggctggatcgcgctgcac
tccggcatggcagcgggcgcgcacgcgatcctcatccccgagcagaagacgagcatggag
cagatcgctgcgtgggtgcgtgccgcctacgaccggggacgggcgccgctcgtggtcgtc
gccgagggcttcgtgccggaccacgaggacaacgcgcacacggagcgcggcctcgacgcg
ttcgggcggccgcggctgggcgggatcggcgagcggctcgcgccgatgatcgaggagatg
acggggatcgagacccgcgccacgacgctcgggcacatccagcgcggtgggaccccgacc
gcgtacgaccgggtgctgtcgacacggctcgggctcgcggcgatcgactccgtggtcgag
gggcggtggggccggatggtcgcgctccagggcacggagatcgtgcacgtgtcgttcgag
gacgccctgggcgagctcaagacggtcccgcaggcgcggtacgacgaggccgccatcatg
ttcggctga

DBGET integrated database retrieval system