KEGG   Corynebacterium ulcerans 210932: Cul210932_0406Help
Entry
Cul210932_0406    CDS       T03406                                 

Gene name
tuf
Definition
(GenBank) Elongation factor
  KO
K02358  
elongation factor Tu
Organism
cun  Corynebacterium ulcerans 210932
Brite
Translation factors [BR:cun03012]
 Eukaryotic Type
  Elongation factors
   Cul210932_0406 (tuf)
 Prokaryotic Type
   Cul210932_0406 (tuf)
Mitochondrial biogenesis [BR:cun03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Cul210932_0406 (tuf)
Exosome [BR:cun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Cul210932_0406 (tuf)
  Exosomal proteins of breast cancer cells
   Cul210932_0406 (tuf)
  Exosomal proteins of colorectal cancer cells
   Cul210932_0406 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
416767..417957
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggtaccatcggtcac
gtcgatcacggcaagaccaccactaccgctgctatcaccaaggttctggctgacgcatac
ccggatctcaacgaggctttcgccttcgacgccattgataaggcaccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtggatgctccgggtcacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgtggttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggttggcgttccttacatccttgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gcagagcaggattacgatgaagaggctccaatcatccacatctccgctctgaaggctctc
gagggcgacgaggagtggaccaagtccatcctcgagctcatgcaggcttgcgacgattcc
atcccggatccagagcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggccgtgttgagcgtggccagctgaacgtc
aacgaagacgttgagatcatcggtatcaaggaaaagtccacccagaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctcctc
ctccgtggtatcaagcgcgaagacgtcgagcgcggtcaggttgttgttaagccaggcgct
tacactcctcacaccgagttcgagggctctgtctacgtcctttccaaggacgagggcggc
cgccacaccccgttcttcgacaactatcgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system