KEGG   Corynebacterium ulcerans 210932: Cul210932_1384Help
Entry
Cul210932_1384    CDS       T03406                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cun  Corynebacterium ulcerans 210932
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cul210932_1384 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cul210932_1384 (ppgK)
Enzymes [BR:cun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cul210932_1384 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1444387..1445139
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGEFVGDRIKILTPKPATPEAVAQTIFRIVTEAEWEG
PVGITLPSVIRNQVALSAANIDKSWINVDVQKLFTKTLGGRNVAVLNDADAAGIAEVTFG
EEQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMLVEGKEAEHLASSAAKDREELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWIPKLTIATPVVPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggtggatctgggattaaaggcgcccgtgtt
gatctggataccggtgaatttgtcggagacaggattaaaattttaacgcccaaacctgcc
acccccgaagcggtcgcccaaacgattttccgcattgttacagaagctgaatgggaagga
ccagtcggaataacgcttccctctgtaatccgaaatcaggtagctctttccgccgctaac
attgacaaatcatggatcaacgttgatgttcagaaactatttaccaaaaccctaggcgga
cgtaacgttgcggtgcttaacgacgccgatgcggcaggcatcgccgaggtcactttcgga
gaagaacaagctcgccgcggctccgccattttgctcactttaggaactggaatcggttcc
gctttctttatcaatggcgtcctattccccaatactgaactaggacacatgctcgtagaa
ggaaaagaagccgagcatctcgcttcatccgcagccaaagaccgtgaagagctaagctat
tccaaatgggccaagcgtgtttctaaagtcctcagcgaatatgaacggctcttttggcca
gacgtatttatcgtaggcggaggaatctcacgcaaagccgataaatggatccctaagctc
actatcgctacacctgtcgtacctgcaaagctacgcaatactgcaggaatcgtaggagca
gcaatggcggctgaccaaaatatccgcccctag

DBGET integrated database retrieval system