KEGG   Cupriavidus sp. USMAA1020: BKK80_05020Help
Entry
BKK80_05020       CDS       T04978                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cup  Cupriavidus sp. USMAA1020
Brite
Enzymes [BR:cup01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKK80_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:1149535..1150116
Genome map
AA seq 193 aa AA seqDB search
MEHTLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKGTEFENATLEEIVKKS
SGGIFNNAAQVWNHTFYFNGLSPKGGGAPAGALADAINAKWGSFDKFKEEFTKTAVGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVEAFWN
LVNWEFVGQNFAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacatactctccccccgcttccctacgcacatgatgcgctcgctccgcacatctcg
aaggagaccctggagttccatcatgacaagcatcaccagacctacgtcacgaacctgaac
aacctgatcaagggcaccgagttcgagaacgccacgctggaagagatcgtcaagaagtcg
tccggcggtatcttcaacaacgccgcccaggtctggaaccacaccttctatttcaacggc
ctgtcgcccaagggcggcggcgctccggccggcgcgctggccgacgccatcaacgccaag
tggggcagcttcgacaagttcaaggaagagttcaccaagaccgccgtgggcaccttcggt
tcgggctgggcctggctggtcaagaaggccgacggttcgctggacctggtctcgacctcg
aacgccgccaccccgctgaccaccgacgccaagccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaatgcccgtccgaagtacgtcgaggcattctggaac
ctggtcaattgggaattcgtcggccagaacttcgccggctga

DBGET integrated database retrieval system