KEGG   Corynebacterium uterequi: CUTER_01560Help
Entry
CUTER_01560       CDS       T03957                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
cut  Corynebacterium uterequi
Brite
Translation factors [BR:cut03012]
 Eukaryotic Type
  Elongation factors
   CUTER_01560 (tuf)
 Prokaryotic Type
   CUTER_01560 (tuf)
Mitochondrial biogenesis [BR:cut03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CUTER_01560 (tuf)
Exosome [BR:cut04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CUTER_01560 (tuf)
  Exosomal proteins of breast cancer cells
   CUTER_01560 (tuf)
  Exosomal proteins of colorectal cancer cells
   CUTER_01560 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
330662..331852
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERKKPHVNIGTIGHVDHGKTTTTAAITKVLADQYPDENEAFAFDAIDKAPEEKE
RGITINISHVEYNTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQEYDEDAPIVHISALKAL
EGDEKWTESIVELMQACDDSIPDPERATDQPFLMPIEDIFTITGRGTVVTGRVERGQLKV
NEDVEIIGIKEKAMSTTVTGIEMFRKLLDYTEAGDNCGLLLRGTKREDVERGQVVIKPGA
YTPHKKFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVE
MSVELIQPVAMDEGLRFAIREGSRTVGAGRVTKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcgaagttcgagcgcaagaagccgcacgttaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccacgacggccgccatcaccaaggttctggccgaccagtac
ccggatgagaacgaggcctttgcgttcgacgccatcgataaggcgccggaggagaaggag
cgtggcatcacgatcaacatctcccacgtcgagtacaacaccccgaagcgccactacgct
cacgtcgacgccccgggccacgctgactacatcaagaacatgattaccggtgctgcccag
atggacggcgctattctcgtcgtcgccgccaccgacggcccgatgccgcagacccgcgag
cacgttctgctcgcccgccaggtcggcgtcccctacatcctcgtcgccctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaggtccgcgagctgctg
gccgagcaggagtacgacgaggacgccccgatcgttcacatctctgctctgaaggctctt
gagggcgacgagaagtggaccgagtccatcgtcgagctcatgcaggcttgcgacgactcc
atcccggatccggagcgcgccaccgaccagccgttcctcatgccgatcgaggacatcttc
accatcaccggccgcggcaccgtcgtcaccggccgtgtcgagcgtggtcagctgaaggtc
aacgaggatgtcgagatcatcggcatcaaggaaaaggccatgtccaccaccgtcaccggc
atcgagatgttccgcaagctgctcgactacaccgaggctggcgacaactgtggcctgctg
ctccgcggcaccaagcgcgaagatgtcgagcgtggccaggtcgtcatcaagccgggcgcc
tacaccccgcacaagaagttcgagggctccgtctacgtcctgtccaaggatgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtcaagctgccggaaggcaccgagatggtcatgccgggcgacaacgttgag
atgtccgtcgagctgatccagccggtcgccatggacgagggcctgcgcttcgccatccgc
gagggctcccgcaccgtcggcgctggccgcgtcaccaagatcctggactaa

DBGET integrated database retrieval system