KEGG   Cupriavidus sp. USMAA2-4: BKK79_12255Help
Entry
BKK79_12255       CDS       T05072                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cuu  Cupriavidus sp. USMAA2-4
Brite
Translation factors [BR:cuu03012]
 Eukaryotic Type
  Elongation factors
   BKK79_12255
 Prokaryotic Type
   BKK79_12255
Mitochondrial biogenesis [BR:cuu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BKK79_12255
Exosome [BR:cuu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BKK79_12255
  Exosomal proteins of breast cancer cells
   BKK79_12255
  Exosomal proteins of colorectal cancer cells
   BKK79_12255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Lsm_C AAA_29
Motif
Other DBs
NCBI-ProteinID: AOY92458
UniProt: A0A1D9GY05
LinkDB All DBs
Position
1:2796004..2797194
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGAAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIID
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggactaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctggctgcgaagttc
ggcggtgccgccaagaagtacgacgaaatcgacgcagcgccggaagagaaggcacgcggt
attaccatcaataccgcccacgtcgagtacgagacggccaaccgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggttggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgagttccccggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgccctggacacc
tacatcccgacgccggagcgtgccgttgacggtaccttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtgatcaag
gtcggtgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtcggtctgctg
ctgcgcggcaccaagcgtgaagacgtggaacgcggccaagtgctgtgcaagccgggctcg
atcaagccgcacacccacttcaccggtgaggtgtacattctgtcgaaggacgaaggcggc
cgtcacaccccgttcttcaacaactaccgtccgcagttctacttccgtacgaccgacgtg
accggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggtctgcgcttcgctatccgt
gaaggcggccgtaccgtcggcgccggcgtcgtggcaaagatcatcgactaa

DBGET integrated database retrieval system