KEGG   Cupriavidus sp. USMAA2-4: BKK79_26530Help
Entry
BKK79_26530       CDS       T05072                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BKK79_26530
   00650 Butanoate metabolism
    BKK79_26530
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKK79_26530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKK79_26530
Enzymes [BR:cuu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKK79_26530
Amino acid related enzymes [BR:cuu01007]
 Aminotransferase (transaminase)
  Class III
   BKK79_26530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1456400..1457662
Genome map
AA seq 420 aa AA seqDB search
MRNADLVRRKDAATPRGVGVMCNFYAERADNAEIWDVEGKRYIDFAAGIAVLNTGHRHPR
LLQAMQEQMARFTHTAYQIVPYASYVELAEKINARAVGAFAKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKVGFGPFPGEIFHAPYPSELHGVSVE
DSLKALQQLFKSDIDPKRVAAIIFEPVQGEGGFHVAPAAFVKALRALCNEHGIVLVADEV
QTGFGRTGKLFAMEHYGVAPDLTTMAKSLAGGMPLSAVCGRAELMDAPAPGGLGGTYAGN
PLAVASALAVLEVLEQEKLVDRGAVLGDRLRDKLEGLRSRVPQIAQVRGVGAMIAVEFKQ
ADGSPDADFTRQVQARALERGLLLLSCGVDGNVIRFLFPLTIPDAVMDEALGILADALLG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatgcagacctggttcgccgcaaggacgccgccaccccgcgcggcgtcggcgtg
atgtgcaatttctacgccgagcgggccgacaatgccgagatctgggacgtcgaaggcaag
cgctacatcgacttcgccgccggcatcgccgtgctgaacacgggccatcgccacccgcgc
ctgctgcaggcgatgcaggagcagatggcgcgcttcacccacaccgcctaccagatcgtg
ccctacgccagctatgtcgagctggccgagaagatcaatgcgcgcgcggtgggggcgttc
gccaagaagaccgccttcttcaccaccggcgcggaagccgtggagaacgccatcaagatc
gcccgcgcggccaccggccggcccggcgtgatcgccttttcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtggcgccctacaaggtgggcttcggcccc
ttcccgggcgagatcttccacgcgccctatcccagcgaactgcacggcgtgtcggtcgag
gactcgctgaaggcgctgcagcagctgttcaagtcggatatcgatccgaagcgcgtggcg
gccatcatcttcgagccggtgcagggcgagggcggcttccatgtggcgcccgccgccttc
gtcaaggcgctgcgcgccctctgcaacgagcacggcatcgtgctggtcgccgacgaagtg
cagaccggcttcggccgcaccggcaagctgtttgccatggagcactacggcgtggcgccg
gacctcaccaccatggccaagagcctggccggcggcatgccgctgtcggccgtgtgcggg
cgcgccgagctcatggatgccccggcgcccggcggcctgggcggcacctatgcgggcaac
ccgctggcggtggcctcggcgctggccgtgctggaggtcctggagcaagagaagctggtg
gaccgcggcgcggtgctgggcgaccgcctgcgggacaagctggaagggctgcgctcgcgc
gtgccgcagatcgcgcaggtgcgtggcgtcggcgccatgatcgcggtcgagttcaagcag
gcggacggcagcccggatgccgatttcacgcgccaggtgcaggcgcgcgcgctggagcgc
ggcctgctgctgctgtcgtgcggcgtggacggcaacgtgatccgcttcctgttcccgctc
accatccccgacgccgtgatggacgaggcgctgggcatcctcgccgacgcgctgctcggc
tga

DBGET integrated database retrieval system