KEGG   Chromobacterium vaccinii: BKX93_18420Help
Entry
BKX93_18420       CDS       T04565                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cvc  Chromobacterium vaccinii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKX93_18420
  Amino acid metabolism
   00310 Lysine degradation
    BKX93_18420
   00380 Tryptophan metabolism
    BKX93_18420
Enzymes [BR:cvc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BKX93_18420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3955555..3958383
Genome map
AA seq 942 aa AA seqDB search
MMQSMYSHSYLFGGNAPFIEELYEQYLVDANSVPNEWRDYFDKLAQSPGAAERDVPHLPI
QESFIQLAKKPVIGQRGAAATDWAAMQKQVGVLKLISAYRVLGARQANLDPLRRMDQAIV
RELDPATHGLNDADMAVQFNVGSLAGPQKLPLSDIIARLKQTYCGNIGVEFMHITQSDEK
HWVQKRFEEALSTPRYDAGKKQRILKQITAAETLERYLHTKYVGQKRFSLEGGESAIAAL
DHLIQNATEQGVQELIIGMAHRGRLNVLVNTLGKLPRDLFAEFEGKAAQQMASGDVKYHM
GFSSDIPTASGPMHVSLAFNPSHLEIVNPVVEGSVRARQDRRKDAERKTAVPVLIHGDSA
FGGLGVNQGTFNLSQTRGYGTGGTIHIVINNQVGFTTSDTRDIRSTMYCTDVAKMIEAPI
LHVNGDDPEAVCFVMQAALDYRMTFKKDVVIDLVCYRKLGHNEGDDPFLTQPMMYKKIAK
HQGVRAMYAERLVQEGVLKAEEADAQIQAYRDALDKGEHVEQTALTNYRREHALDFSQYL
GTHWAHPTDTSLPQADIQRLTDKFTTLPEGFKLHPTVQKVLAARKAMAAGEQNVDWGMAE
TLAYASLVTNGFGVRLSGEDSGRGTFSHRHSVLHDQNRESWDQGSYVPLRNMSDNQADFL
VIDSILNEEAVLAYEYGYACSAPDQLVIWEAQFGDFANGAQVAIDQFISSGETKWGRLCG
LTTILPHGYDGQGPEHSSARLERWLQLCAEHNMQVVMPSEAGQMFHMLRRQVLRPYRKPL
VIFLSKRLLRFKDSMSPVEDLTSGSFRPVIGDVVVKDPKKVKRVLLCAGQVYYDLAAARK
ERSLDDDIAIVRIEQLYPFPTEQVAAELARFTQAKEVMWVQEEPRNQGAWYQIRHRLEGL
LTAKQQLSFAGRPSSASPAVGYMSKHVAQLKAFVEEAMSVAR
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaatccatgtacagccattcctatctgttcggtgggaatgccccgttcatcgag
gagctgtacgaacagtacctcgttgacgccaactcggttccgaacgagtggcgcgactac
ttcgacaagctggcgcagtcgccgggcgccgccgagcgcgacgtgccgcacttgccgatc
caggagtcgttcatccagctggcgaagaagccggtgatcggccagcgcggcgccgccgcc
accgattgggcggcgatgcagaagcaggtgggcgtgctcaagctgatctccgcctaccgc
gtgctgggcgcgcgccaggccaacctggacccgctgcgccggatggaccaggccatcgtg
cgcgagctggacccggctacccacggtctgaacgacgccgatatggcggtgcagttcaac
gtcggctcgctggccggcccgcagaagttgccgctgtccgacatcatcgcccgtctgaag
cagacctactgcggcaatatcggcgtcgaattcatgcacatcacccagtccgacgagaag
cactgggtgcagaaacgcttcgaggaggcgctgtccactccgcgctacgacgcgggcaag
aagcagcgcatcctgaagcagatcaccgccgccgaaacgctggaacgctacctgcacacc
aagtacgtcggccagaagcgcttctcgctggaaggcggcgagtccgccatcgcggcgctg
gaccacctgatccagaacgccaccgagcagggcgtgcaggaattgatcatcggcatggcc
caccgcggccgtctgaacgtgctggtcaacaccctgggcaagctgccgcgcgacctgttc
gccgaattcgaaggcaaggccgctcagcagatggcctccggcgacgtgaagtaccacatg
ggcttctcgtccgacatcccgaccgccagcggcccgatgcacgtgtcgctcgcgttcaac
ccgtcgcacctggaaatcgtcaacccggtggtggaaggttcggtgcgcgcgcgccaggat
cgccgcaaggacgccgagcgcaagaccgcggttccggtgctgatccacggcgactccgcc
ttcggcggcctgggcgtcaaccagggcaccttcaacctgtcgcagacccgcggctacggc
accggcggcaccatccacatcgtcatcaacaaccaggtgggcttcaccacttcggacact
cgcgacatccgctcgacgatgtactgcaccgacgtggccaagatgatcgaagcgccgatc
ctgcacgtgaacggcgatgatccggaagccgtctgcttcgtgatgcaggccgcgctcgac
taccgcatgaccttcaagaaggatgtggtgatcgacctggtgtgctaccgcaagctcggc
cacaacgagggcgacgatcccttcctgacccagccgatgatgtacaagaagatcgccaag
caccagggcgtgcgcgcgatgtacgccgagcgcctggtgcaggagggcgtgctgaaggcc
gaggaggctgacgcgcagatccaggcctaccgcgacgcgctggacaagggcgagcacgtc
gagcagaccgcgctgaccaactaccgccgcgagcacgcgctggacttcagccagtacctg
ggcacccactgggcgcacccgaccgacacctcgctgccgcaggccgacatccagcgtctg
accgacaagttcaccacgctgccggaaggcttcaagctgcacccgaccgtgcagaaagtg
ctggccgcgcgcaaggcgatggccgccggcgagcagaacgtcgactggggcatggccgag
acgctggcctacgcgtcgctggtgaccaacggtttcggcgtgcgcctgtcgggcgaggac
tccggccgcggcaccttctcccatcgccactcggtgctgcacgaccagaaccgcgagagc
tgggaccagggcagctatgtgccgctgcgcaatatgtccgacaaccaggccgatttcctg
gtgatcgactccatcctgaacgaggaagcggtgctggcctacgaatacggctacgcctgt
tccgctccggaccagctggtgatctgggaagcccagttcggcgacttcgccaacggcgcc
caggtggccatcgaccagttcatctcttccggcgagaccaagtggggtcgtctgtgcggc
ctgaccaccatcctgccgcacggctacgacggccagggcccggagcactcctccgcccgc
ctggagcgctggctgcagctgtgcgccgagcacaatatgcaggtggtgatgccgtccgaa
gccggccagatgttccacatgctgcgccgccaggtgctgcgtccgtaccgcaagccgctg
gtgatcttcctgtccaagcgcctgctgcgcttcaaggattcgatgagcccggtcgaagac
ctgacttccggcagcttccgcccggtgatcggcgacgtggtggtcaaggatccgaagaag
gtcaagcgcgtgctgctgtgcgccggccaggtgtattacgacctcgccgcggcccgcaag
gagcgcagcctggacgacgacatcgccatcgtgcgcatcgagcagctgtacccgttcccg
accgagcaggtggccgccgagctggcgcgcttcacccaggccaaggaagtgatgtgggtg
caggaagagccgcgcaaccagggcgcctggtaccagatccgccaccgcctggagggtctg
ctgaccgccaagcagcagctgtcgttcgccggccgtccgtcgtcggcttcgccggcggtc
ggttatatgagcaagcacgtcgcccaactgaaggccttcgtcgaagaagcgatgtcggtc
gcccgctga

DBGET integrated database retrieval system