KEGG   Chromobacterium vaccinii: BKX93_22170Help
Entry
BKX93_22170       CDS       T04565                                 

Definition
(GenBank) AMP-binding protein
Organism
cvc  Chromobacterium vaccinii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4805045..4806781)
Genome map
AA seq 578 aa AA seqDB search
MQTHASMTDAILSALEHSQSGAERHIAIFEENGEEKRIPHTDLARRALAVAAALRELGAS
RNDLVILALPASIDHLLLQTGLALLGALPCTVPLPGRTQADSSRNQIHLACRLFSPRLLI
AAPPQADILRQQLAGLPVRVLSTTEVELAAEAAGSIQPFRAGPDDAHHVQLTSGSTGRPK
AVVLSHRNVIDNVRGIGGVVGYDPARGDASASWLPLYHDMGLVTLLSNLYYQAPLLLMQP
SGFIRNPLGWLKRIASFGATTTATPTFGLQYCVRRYRAASMQDVDLSCLRNIFIGAERVD
LACLQEFSRVFEAHGLSRSALQPCYGMAETTLAATMHDATAGYDRQAFSYLIPDRIDSDA
LVAEAVARPADARTRAAETVLAMGKPIPGMSLRVVDANGAEAEARKIGEIQLRGSSLMSG
YLPAEGQNEPYRPGEWFATGDLGYLADGQLFVLGRQKEIIIIRGSNYFPHEIEDTLATHP
LLAGGNAIAATGVYDKTQGTENLIAMIEFEREDEQPALRAELQAMLRERFGFGAHAIVFV
ANGSLPRTTSGKLQRLKCRGLYIERALRGENQETATPA
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
ttgcagacccacgcatcaatgacggacgctattttatctgcgctggaacattcccagtcg
ggcgcagagcgacacatcgccatatttgaggaaaacggcgaagaaaaacgaatcccccat
accgatctggcccgccgcgcgctggccgtcgccgcggctctgcgcgaattgggcgcgtca
cgcaacgatctcgtcatactggcgctgcccgcctccatcgaccacctgctgctgcaaact
ggcttagcgctgctgggcgccctgccctgcaccgtgccgctgccgggccggacgcaagcc
gactcttcgcgcaaccagattcatctcgcctgccggctgttctcgccgcgcctgctgatc
gctgcgccgcctcaggccgacatcctgcggcagcaactcgccgggctgccggtgcgcgtg
ctctccactacggaggtggagctggcagccgaggccgccggttcgatccagcctttccgc
gccggcccggacgacgcccaccacgtgcagctgacctccggctccaccggccgccccaaa
gccgtggtgttgagccaccgcaacgtcatcgacaatgtgcgcggcatcggcggcgtcgtc
ggctacgatccggcgcgcggcgacgcctccgccagctggctgccgctctaccacgacatg
ggcctggtcacgctgctgtccaatctttactaccaggcgccgctgctgctgatgcagccg
tccggcttcatccgcaacccgctgggctggctcaagcgcatcgcctccttcggcgccacc
accacggccacgcccaccttcggcctgcaatactgcgtgcgccgctaccgcgccgcgtcc
atgcaggacgtcgacctctcctgcctgcgcaacatcttcatcggcgccgagcgggtcgac
ctggcttgcctgcaggaattttcccgggtgttcgaagcgcacgggctgtcgcgttcagcg
ctgcagccttgctacggcatggcggaaaccacgctggccgccaccatgcacgacgccacc
gccggctacgaccgccaggcgttttcctatctgatccccgaccggatcgattccgacgcc
ctcgtcgccgaggccgtcgcccgccccgccgacgcgcggacgcgcgccgcggaaacggtg
ctggcgatgggcaagccgattcccggcatgtcgctgcgcgtggtcgacgccaacggcgcc
gaggccgaagcgcgcaagatcggcgagatccaactgcgcggcagttcgctgatgtccggc
tatcttcccgccgaagggcagaacgagccttaccggccaggcgaatggttcgccaccggc
gacctcggctatctcgccgatggccagctgttcgtgctcggccggcaaaaggaaatcatc
atcatccgcggcagcaactatttcccccacgaaatagaagacacgctggccacccacccg
ctgctggcaggcggcaacgccatcgccgccactggcgtctacgacaaaacccagggcacc
gagaacctgatcgcgatgatcgagttcgagcgcgaagacgagcagcccgcgttgcgcgcc
gaactgcaagccatgctgcgcgaacgcttcggcttcggcgcccacgccattgtcttcgtc
gcgaacggcagcctgccgcgcaccaccagcggcaagctgcaaaggctgaaatgccgcggc
ctctacatcgagcgggccttgcgcggcgagaatcaggaaacggcgacaccagcctga

DBGET integrated database retrieval system