KEGG   Chlorella variabilis: ChvaP_p029Help
Entry
ChvaP_p029        CDS       T02924                                 

Gene name
rbcL
Definition
(RefSeq) large subunit of Rubisco
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cvr  Chlorella variabilis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ChvaP_p029 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ChvaP_p029 (rbcL)
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ChvaP_p029 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
PT
AA seq 475 aa AA seqDB search
MAPQTETRAGAGFKAGVKDYRLTYYTPDYQPKDTDILAAFRMTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEENQYIAYIAYPLDLFEEGSVTNLFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRGLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWKDRFLFVAEAIYKSQSETGEIKGHYL
NATAPLLEKRFKRAECAKDLGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYIEKDRSR
GIYFTQDWVSLPGTMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAAN
RVALEACTQARNEGRDLAREGGDIIRAACKWSPELAAACEVWKEIKFEFETIDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctccacaaactgaaactagagcaggtgctgggtttaaagcaggtgttaaagactac
cgtttaacttactatactcctgattaccaaccaaaagacactgatattcttgcagcattc
cgtatgactcctcaaccaggtgttccaccagaagaagctggtgcagcggtagcagcagaa
tcatcaactggtacttggacaactgtatggactgatggtttaactagtttagatcgttac
aaaggccgttgttatgacatcgagccagttccaggtgaagaaaaccaatacattgcatat
attgcatatcctttagatctttttgaagaaggatctgtaactaatttatttacttcaatt
gtaggtaacgtttttggtttcaaagctcttcgtgctttacgtttagaagatcttcgtatt
ccaccagcatacgtaaaaactttccaaggtcctcctcatggtattcaagtagaacgtgat
aaacttaacaaatatggtcgtggtttattaggttgtacaattaaaccaaaattaggtctt
tcagctaaaaactacggtcgtgctgtatacgaatgtttacgtggtggtcttgatttcact
aaagatgatgaaaacgtaaactctcaaccattcatgcgttggaaagatcgtttcttattc
gttgcggaagctatctacaaatctcaatctgaaacaggggaaattaaaggtcactattta
aatgcgaccgcaccactgctggagaaaaggtttaaacgtgcggaatgtgcaaaagattta
ggtgtacctattgttatgcatgactacttaactggtggtttcacagcaaacacaagttta
gctcattactgtcgtgataatggtcttcttctacacattcaccgggcaatgcacgcggta
attgaccgtcaaagaaatcatggtattcacttccgtgttttagcaaaagctcttcgttta
tctggtggtgaccacttacactctggtacagttgtaggtaaattagaaggtgaacgtgaa
gtaacgttaggtttcgttgacttaatgcgtgatgactacattgagaaagatcgtagccgt
ggtatctacttcactcaagactgggtttctttaccaggtacaatgccagtagcttctggt
ggtattcacgtatggcacatgccagctctagttgagattttcggtgatgatgcttgttta
caattcggtggtggtactttaggtcacccttggggtaacgctccaggtgctgctgcaaac
cgtgttgctttagaagcatgtactcaagcgcgtaatgaaggtcgtgaccttgctcgtgaa
ggcggtgatattatccgtgcagcttgcaaatggagtcctgaattagctgctgcttgtgaa
gtttggaaagaaattaaatttgaattcgaaacaatcgatactctttaa

DBGET integrated database retrieval system