KEGG   Corynebacterium vitaeruminis: B843_12380Help
Entry
B843_12380        CDS       T03042                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cvt  Corynebacterium vitaeruminis
Brite
Enzymes [BR:cvt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B843_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2780011..2780613
Genome map
AA seq 200 aa AA seqDB search
MAKYELPALDYDYDALEPYISAEIMELHHSKHHQNYVNGANAALEKLEDARKNGYVGAAV
TALSKDLAFNLGGHTNHSIFWKNLSPNGGGEPTGALADAIARDFGSFEAFKEHFSAAALG
LQGSGWAVLGYDKIGERLVIEQMTDQQGNLSIDLEPLLLLDMWEHAFYLQYKNVKADYVK
AVWNVFNWEDVAARYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtacgaacttcctgcgctcgactacgactacgacgcgctcgagccttacatc
tccgccgagatcatggagctgcaccactccaagcaccaccagaactacgtcaacggcgcc
aacgccgctctggagaagcttgaggatgcacgcaagaacggctacgtcggcgccgccgtg
accgccctgtccaaggacctggccttcaacctgggtggccacaccaaccactccatcttc
tggaagaacctgtccccgaacggtggcggcgagccgaccggcgccctggctgacgccatc
gcccgtgacttcggttccttcgaggccttcaaggagcacttctccgcagccgctctcggc
ctgcagggctccggctgggcggtcctcggctacgacaagatcggcgagcgcctggtcatc
gagcagatgaccgaccagcagggcaacctgtccatcgatctcgagccgctgctgcttctc
gacatgtgggagcacgccttctacctccagtacaagaacgtcaaggctgactacgtcaag
gcagtctggaacgtcttcaactgggaggacgtcgctgctcgctacgaggcagccaccaag
taa

DBGET integrated database retrieval system