KEGG   Crocosphaera watsonii: CwatDRAFT_2716Help
Entry
CwatDRAFT_2716    CDS       T05097                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cwa  Crocosphaera watsonii
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cwa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CwatDRAFT_2716
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CwatDRAFT_2716
Enzymes [BR:cwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CwatDRAFT_2716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
14380..14715
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQILLQVQNVLDQGMIPGVEFEEDPSPTTHFWTMWKLPL
FNAVSAQEVLAEVRECRSEYPNAYIRVIGFDNIKQCQTMSFIVHKPNNRAY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacccaaagagcgtcgttacgaaaccctttcttatttaccccctttaacc
gaccaacaaattctgctccaagttcagaatgtcttggatcaagggatgattcctggggtt
gagtttgaagaagatcccagcccaaccactcacttctggacaatgtggaagttacctttg
tttaatgctgtttctgctcaagaagtgttagctgaagtacgggaatgtcgttctgagtat
cctaacgcttatattcgtgtaattggtttcgacaacatcaaacagtgtcaaaccatgagt
ttcatcgttcataagcccaacaaccgtgcatactaa

DBGET integrated database retrieval system