KEGG   Citrobacter werkmanii: CO701_16830Help
Entry
CO701_16830       CDS       T05129                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00730  Thiamine metabolism
cwe00790  Folate biosynthesis
cwe01100  Metabolic pathways
cwe02020  Two-component system
Module
cwe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cwe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CO701_16830
   00790 Folate biosynthesis
    CO701_16830
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CO701_16830
Enzymes [BR:cwe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CO701_16830
Exosome [BR:cwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CO701_16830
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cwe00537]
 Enzymes
  CO701_16830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ATF50662
UniProt: A0A291D2K6
LinkDB All DBs
Position
complement(3347920..3349335)
Genome map
AA seq 471 aa AA seqDB search
MKQSALAIALLPLLFTPVIYAESSAVPVMDNRAAQGDITTPGGARRLAGDQTAALRDSLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHATILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTREKCPTNALENGGKGSITEQLLNARADVTLGGGAKTFAETAAAG
EWQGKTLREQAQMRGYQLVSDATSLAAITDASQDKPLLGLFSEGNMPVRWEGPKASYHGN
IDKPAVTCTPNAKRNDTVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKSALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgcactcgctattgccctgttacctttgctgtttaccccggttatttat
gcagaatcatctgctgtgccggttatggataatcgcgccgctcagggggatatcaccacg
ccgggtggcgctcgccgattagccggcgatcaaacggccgctctgcgtgattcactgatt
aataaaccggctaaaaatattattttgctgatcggcgatggtatgggtgactcagaaatt
actgcagcgcgaaattatgccgaaggcgcgggcggcttttttaaagggattgatgcgcta
cccctgactggacaatacacccactattcgctggataagaaaacgggtaaacccgattac
gtgacagattcagcggcttcggcaacggcgtggaccaccggggtgaaatcctataatggt
gcgctgggcgttgatatccatgaaaaagatcacgccacgattctggaaatggcaaaagcc
gcaggtctggctaccggcaacgtttctactgctgaattacaggatgccactccggctgcg
ctggttgcgcatgtgacgtcacgtaaatgctacggtccgagcgtgacccgtgaaaaatgc
ccgactaatgcgctggaaaacggcggtaaagggtcaatcactgaacaattgttgaatgcc
cgtgccgacgtcacgctggggggcggggcaaaaacgtttgctgaaaccgctgctgcgggt
gaatggcagggcaagacgctgcgtgagcaggcgcagatgcgtggctatcagttggtgagc
gacgcgacatcgcttgcggcaatcactgacgccagtcaggataaaccgctgctggggttg
ttctctgaaggtaatatgccggtgcgttgggaaggaccaaaagcctcgtatcatggcaac
attgataagccggctgtgacctgtacgccaaatgccaaacgcaacgacacggtgccgacg
ctggcacagatgacggataaagcgattgagctgttaagcaaaaatgaaaaaggcttcttc
ctgcaggtggaaggcgcgtcaatcgataaacaggatcatgctgctaacccgtgcgggcag
attggcgaaacggtcgatctggacgaagccgtacagcgcgcgctggcctttgcgaagaaa
gacggtaatacgctggtggtggtaaccgccgatcacgcgcatgccagccagatagtggcg
ccagataccaaagcgccgggcctgactcaggcgctgaacaccaaagatggcgcggtgatg
gtcatcagttacggcaactctgaagaagaatctcaggagcatacgggcagccaactgcgt
attgctgcctatgggccgcatgcggcgaatgtggttggcctgaccgaccagaccgatttg
ttctacaccatgaaatcggccttagggctgaaataa

DBGET integrated database retrieval system