KEGG   Citrobacter werkmanii: CO701_22330Help
Entry
CO701_22330       CDS       T05129                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cwe  Citrobacter werkmanii
Pathway
cwe00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cwe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CO701_22330
Enzymes [BR:cwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CO701_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF2194 ABC_transp_aux Cellulase Glyco_hydro_42C Glyco_hydro_2_C MAF_flag10 DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: ATF51641
UniProt: A0A291D5E6
LinkDB All DBs
Position
complement(4522909..4524948)
Genome map
AA seq 679 aa AA seqDB search
MTGLYYGVAYYDEYIREERLEKDIEMMVAAGINVVRIAESTWSTLEPEENTFNFYHIDRV
LGAMHRAGISVIIGTPTYAIPGWLARKHPDALVTTPAGHEKYGRRQIMDIVNPHFLQHAE
KVIRALLNHVHHHPAIIGYQVDNETKHYDNTGEDIQAAFIASLKKQFPDIRQMNDAFGLE
YWSNRIDCWEDFPPVASTINASLGCAFARFRREKIAEYLAWQADIVREYARPEQFVTQNF
DFEWRGYSFGLQPQVDHFSAAQAMSVVSVDVYHPGQDHLSGREIAFSGDVARNLKNGRNY
YVMETQAQGFAKWTPWPGQLRLQAFSHIASGASMVSYWHWHSIHNSYETYWKGLISHDFA
PGPTYQEAMTIGQEMAQLSGVLNELRVENDVAILVSNDAMEAMNWFKPDTPQPGLNNHGH
YVYNDILRRFWDALYDNNIAVDIINTLDPQNSQYKVVVIPALYCASDEQLERINQFVENG
GKVLIGFKSGFCDENVRVRAETQPAILNKCCGVSYSQFVIPENVGLRSETEALVCAPDEH
PELWMELLTPNTEKTAVLLRYDHPVWGKYAAATLSNYGKGQALYVGCLPSSKVIFDLFSA
LSSDTPLVSSTPEYQWPLVVRRAVNSRGEAVQFIFNYCATPATIRTEAEVTEPLSGKRYH
QGERVEIDAWGMRLFVKSR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtctttattatggtgtggcctattacgatgagtacattcgtgaggagcgcctg
gaaaaagatatcgagatgatggtcgccgctggcattaatgttgtcagaattgcggaatca
acctggagcacgctggagcctgaagaaaatacgttcaatttctaccatattgatcgcgtg
ctcggcgccatgcaccgcgcgggcatctccgttattatcggcacgccaacctacgccatc
cccggctggctggcgcgtaaacacccggatgcgctggtcactacgccagctggccatgaa
aaatatggccgtcggcagattatggatatcgttaatccgcatttccttcagcatgccgaa
aaggttattcgcgccctgcttaatcatgttcaccaccatccggcgattattggctatcag
gtcgataatgaaaccaagcattatgacaataccggcgaagatattcaggcggcgtttata
gcatcattgaaaaaacagttcccggatatccgtcagatgaatgatgcctttgggcttgag
tactggagcaatcgcattgattgttgggaagatttcccccctgtcgccagcaccatcaac
gccagcctcggctgcgcttttgctcgctttcgtcgagagaagatcgcggaatatctggcc
tggcaggccgatatcgtgcgggaatacgcgcgtccagagcagtttgtcacgcaaaacttc
gattttgaatggcgcggttattcttttgggcttcagccgcaggtcgatcacttttctgcc
gcgcaggcaatgagcgttgtcagcgttgacgtttatcatccaggtcaggatcatcttagc
gggcgggaaatagccttcagcggcgatgtggcgaggaacctgaaaaatgggcgcaactat
tatgtcatggagacgcaggcccagggctttgccaaatggacaccgtggcctggtcaatta
cgcttgcaggccttcagccatatcgccagcggcgccagcatggtttcttactggcactgg
cattcgatccacaactcctatgaaacctactggaaagggctgatcagtcatgatttcgct
ccaggcccaacttaccaggaagcgatgactatcggtcaggagatggctcagctgtccggc
gttcttaacgaactgcgcgtagaaaacgatgtcgcgattctggtcagcaatgatgcgatg
gaagccatgaactggtttaaacccgataccccgcaacccgggctgaacaaccacggtcat
tacgtttacaacgatatcctgcgacggttctgggatgcgctttatgacaataatatcgcg
gtggatatcatcaacaccctcgacccgcagaacagtcaatacaaggtcgtggttatcccg
gcgctctactgtgcaagcgatgaacagcttgagcgtatcaaccagtttgttgaaaacggc
ggcaaagtgctgattggctttaagtccggattttgtgatgagaatgtcagagtgcgcgct
gaaacccagcctgcaatactgaataaatgctgcggcgtcagctacagccagttcgtcatc
ccagaaaacgtggggctgcgatctgaaactgaagcattggtttgcgccccggatgagcac
ccggaactgtggatggagctgctgacgccgaacactgaaaagaccgccgttctgctgcgt
tatgaccacccggtctggggaaaatatgccgccgccacgctgtcgaattacggtaaaggg
caagcgctctatgttggctgtttgccctccagcaaggtgatatttgacctgtttagcgcg
ctctcatcagacacgccgttggtctcctctacgccagagtatcagtggccgctggttgtt
cgccgcgccgtaaacagccggggcgaggcggtgcaatttattttcaattattgcgccacg
cctgcaacaatccgtactgaggccgaagtgacggaaccgctgagcgggaaacggtatcat
cagggagaacgcgttgagattgatgcctggggcatgcggttgtttgtgaaatcacggtaa

DBGET integrated database retrieval system