KEGG   Synechococcus sp. JA-3-3Ab: CYA_1196Help
Entry
CYA_1196          CDS       T00318                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase, small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYA_1196 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_1196 (cbbS)
Enzymes [BR:cya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CYA_1196 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1209115..1209447
Genome map
AA seq 110 aa AA seqDB search
MQTLPKERRYETFSYLPPMTDLQILKQVQYILDQGYIPAIEFNESSQPTDHYWTLWKLPL
FSATSPQEVLTEVQACRSAYPNCFIRVVGFDNIKQCQVLSFLVYKPSGLR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttgccgaaagagcgccgctacgaaactttttcctacttgcctccgatgacg
gatctgcagatcctcaagcaggtgcagtatatcttggatcaaggctacattcctgccatc
gaattcaacgagtcttcgcagcccaccgaccactactggacgctgtggaaattgcccctg
ttcagcgccacttctccccaggaggtgctgaccgaggtacaggcctgccgcagcgcctac
cccaattgcttcatccgtgtggtgggtttcgacaacattaagcagtgccaggtgctcagc
ttcttggtttacaagcccagcggcctgcgctag

DBGET integrated database retrieval system