KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0036Help
Entry
CYB_0036          CDS       T00319                                 

Gene name
ntrB-1
Definition
(GenBank) nitrate ABC transporter, permease protein NrtB
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CYB_0036 (ntrB-1)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CYB_0036 (ntrB-1)
Transporters [BR:cyb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    CYB_0036 (ntrB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
45169..46128
Genome map
AA seq 319 aa AA seqDB search
MRIFHSALQLGYHLFRILLPLLVGLGHWLLKTGQGSVLQSSTGIGSPASSAPSSAWRQRV
QIHKALRRILLPATAILLVLILWQIIYSRPGANLPTPLQVWQDTWDPLIKDPFFDYGGNA
KGLFWQIWASLRRVFIGFALAGLVGVVGGMIIGVNRWLYEALDPIFQVLRTVPPLAWLPI
SLAAFRDANPSAIFVIFITALWPILINTVVGVQQIPQDYRNVARIVRMSGWKYFFKIVFP
ATVPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSRISEIILALIYVGMVG
LLLDRITAWIGSLVVAEDR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttccactctgccctacagttgggctaccacctctttcggatcctgcttccc
ctactggttggcctaggccactggctgctgaaaaccggccaaggttctgttcttcagtcc
agtaccggaatcggttcccccgccagttctgcaccttcttctgcttggcggcaaagagtc
caaatccacaaagcgctgcgtcgcattctgttgcccgctacggccattttgctcgtcctg
attctctggcaaatcatttacagccgccccggagccaacttgcccacccctctccaggtt
tggcaggacacctgggatcccctcattaaagatcccttttttgactatggcggcaatgcc
aaagggctgttctggcaaatttgggccagcttgcggcgggtgttcattgggtttgccctg
gccggcttggtgggggttgtgggcggcatgatcatcggggtcaatcgctggctgtacgag
gctttggatcccatttttcaggtgctgcgcacggtgccgcctttggcctggctgccgatt
tctttggctgcctttcgagatgccaacccttccgccattttcgtaatcttcattacggcc
ctctggcccattttgatcaacaccgttgtcggcgtacagcagatcccacaggactaccgc
aacgtggccagaattgtgcgcatgtccggctggaagtactttttcaaaatcgttttcccg
gcaactgtgccctatatttttaccggcttgcgcattggggtgggcttgtcttggctggcc
attgtggcagcggaaatgttgattggcggtgtgggcatcgggttcttcatctgggatgcc
tggaatagctcccgcatcagcgaaatcattctggctttgatctatgtcgggatggtgggt
cttctgctggatcggatcacggcttggattggctcgctggtggtggctgaggatcgctaa

DBGET integrated database retrieval system