KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2109Help
Entry
CYB_2109          CDS       T00319                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYB_2109 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYB_2109 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CYB_2109 (ddlB)
Enzymes [BR:cyb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CYB_2109 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:cyb01011]
 Precursor biosynthesis
  Amino acid ligase
   CYB_2109 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2202565..2203542)
Genome map
AA seq 325 aa AA seqDB search
MNIVVLAGGRSAERQVSWVTGKACKRALEDLGHRVKVIDPDEDLPLRLWQERQAGCDFVW
IALHGPGGEDGVVQGMLDWLGLPYQGSGPLASALAMDKLVSKQIFRAAGIPTPDWQVWDD
QNPLTWADCAAELGSPLVIKPSNNGSTVGISIVRDERSFAQGLELARSVSSRIFLERYVP
GKEITLSILSGQVLPAIEIIPAQGDFYDYEAKYAPGGSRHLIPCSLSPAGLARCEAAGLK
AYQALGCEGLARVDLRVDPEENPWVLEVNTLPGMTPTSLCPDAAAALGWTFTELVERMLQ
DALQKAQLTGSRHPQSSSATLGNAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgttgtcttggcgggggggcgttcggcagaacgtcaagtctcttgggtaacg
ggtaaagcctgcaaacgggctttggaggacctgggccatcgggtcaaggtaatcgaccca
gatgaggatctgcctctgcgcctttggcaggaacggcaagccggctgcgacttcgtttgg
attgccttgcatggccctggtggcgaggatggggtggtacagggaatgctggactggctg
ggcctgccctaccagggatccgggccgctggccagtgctctggccatggataagctggtc
tccaagcagatctttcgcgccgcggggatccctacccccgattggcaggtttgggatgac
caaaaccccctcacttgggccgactgtgcggcagagttgggatccccactggtgattaag
cccagcaacaacggctcgacggtgggcatcagcattgtccgggatgagaggtcatttgct
caggggctggagttggcccgctcggtctcgtcgcggatttttctggagcgctatgttccc
ggaaaggagatcaccctctcgatcttgtccggccaagttcttccggccattgagatcatc
cccgcccaaggcgacttctacgactacgaagccaagtacgcacccggtggctcgcggcat
ttgatcccctgttccctcagcccggcagggttggcccgctgtgaggcggcaggtctgaag
gcctaccaggcgttggggtgcgaaggcttggcgcgggtggatctgcgggtggatcccgag
gaaaatccttgggtgttggaggtgaatacactgcccggcatgacccccacttccctctgt
cccgatgcggcggcagctctggggtggacgttcaccgagttggtggagcgaatgctgcag
gatgccttgcaaaaagcccaattgaccggatcccggcatcctcaaagttcatcggcgact
ctcggcaacgctccctga

DBGET integrated database retrieval system