KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2579Help
Entry
CYB_2579          CDS       T00319                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYB_2579 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_2579 (cbbL)
Enzymes [BR:cyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CYB_2579 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2682338..2683762)
Genome map
AA seq 474 aa AA seqDB search
MAYSATQSKSGYQAGVKDYRLTYYTPDYTPKDTDVLACFRVTPQPGVPPEEAGAAVAAES
STGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYFCFVAYPLDLFEEGSVTNMLTSIV
GNVFGFKALKALRLEDVRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLS
AKNYGRAVYEALRGGLDFTKDDENINSQPFQRWRDRYLFVMEAVHKAQAETGEIKGHYLN
VTAPTCEEMFKRAEFAKELGAPIIMHDYLTAGFTANTSLAKWCRDNGILLHIHRAMHAVI
DRQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGDRAITMGFVDLMRENYVEADRSRG
IFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANR
VALEACIQARNEGRDLAREGNDIIREAAKWSPELAAACELWKEIKFEFKAVDTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtggcctattcagcaacccaatccaaaagcggctatcaagccggtgtgaaggattaccga
ctcacctattacactcccgactacacgcctaaggataccgatgtcttggcctgtttccgg
gttactcctcagccgggtgttcctcccgaagaggcgggggcagccgtggcggctgagtct
tcgacgggcacctggacaacggtatggaccgatttgcttaccgacttggatcggtacaaa
ggccgctgctatgacatcgagccggttcccggcgaagacaaccagtacttctgcttcgtc
gcctatccgctggatctgttcgaggaaggctcggtgaccaacatgctcacctcgattgtg
ggcaacgtttttggctttaaggccctaaaggcgctgcggctggaagatgtacgaattccg
gtggcctacctgaaaaccttccagggccctccccacggcattcaggtggagcgggataag
ttgaataagtatggccgtccgctgctgggctgcaccatcaaacccaagctgggcctttct
gccaaaaattacgggcgggccgtgtatgaagctctgcggggcggcctggacttcaccaaa
gatgacgaaaacattaactcccagcccttccagcgctggcgggatcgctacttgttcgtg
atggaggctgtccacaaggcccaagcggaaaccggcgagatcaagggccactatttgaac
gtgacggcgcccacctgcgaagagatgttcaagcgggccgagtttgccaaggagttgggc
gcccctatcatcatgcacgactacttgacagccggctttactgccaacaccagcttggcc
aagtggtgccgggataacggcattctgctgcacattcaccgggccatgcacgcggtgatc
gaccggcagaaaaaccatggcatccacttccgggtgttggccaagtgtttgcgcatgtcc
ggtggcgaccacctgcactctgggacggtggtgggcaagttggaaggcgaccgcgccatc
acgatgggctttgtggatctcatgcgggaaaactacgtagaggccgatcgctcccgcggc
attttcttcacccaagattgggcttccatgccaggggtgatgccagtggcttccggtggg
atccacgtttggcacatgccggcgctggtggagatcttcggcgacgactcggtgctgcag
tttggcggcggaaccttgggacacccctggggcaacgcgccgggcgcaaccgccaaccgg
gtggccttggaagcgtgtatccaagctcgtaacgaaggtcgagatctggcccgcgaaggc
aacgacattatccgggaagcagccaagtggtcgccagagctggcggctgcctgcgagctg
tggaaggaaatcaagttcgagttcaaggccgtcgacaccctctag

DBGET integrated database retrieval system