KEGG   Cyanobium sp. NIES-981: CBM981_1173Help
Entry
CBM981_1173       CDS       T04888                                 

Gene name
gadA
Definition
(GenBank) glutamate decarboxylase A, PLP-dependent
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:cyi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CBM981_1173 (gadA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBM981_1173 (gadA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBM981_1173 (gadA)
   00430 Taurine and hypotaurine metabolism
    CBM981_1173 (gadA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CBM981_1173 (gadA)
Enzymes [BR:cyi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CBM981_1173 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(1066266..1067654)
Genome map
AA seq 462 aa AA seqDB search
MALHLTRPTRADAVLHSEEFTRPLPRDRFPQHGQEAAATAEILSDELLLDGNSKQNLATF
CQTTEGPQVHALMDLAMDKNLIDKDEYPQTAELERRCVALLADLWHAPAGAIGCSTIGSS
EAAMLGGMAAKWRWRARQQAAGRPTDKPNMVCGSVQICWHKFARYWDIELREITMEPGRL
CLTAEDVLSRVDENTILVVPTLGVTYHGLYEDVASLSAALDGLQQRSGLDIPIHVDAASG
GFLAPFTAPHLPPWDFRLERVKSINASGHKFGLGPLGVGWVLWRQASDLPSELVFKVSYL
GGDMPTFQINFSRPAGQVIAQYYTFVQLGREGYRRIHAVSHAVAQVVAAALQAMPLFEVL
HDGNPHRGIPAVVWRLAPGQDPGFSLYDLADRLRVRGWQVPAYPLTGSLASTPFQRILVK
RGFTREMADLLVEDIRQAVDHLHNHPRAVPLSAEEAASYNHL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcacctcacgcgccccacccgggcggatgccgttctccacagcgaggagttc
acccggcccctgccccgcgaccgcttcccccagcacggccaggaggccgccgccaccgcc
gagatcctcagcgacgagctgctgctcgatggcaacagcaagcagaacctcgccaccttc
tgccagaccaccgagggcccccaggtgcatgccctgatggacctggccatggacaagaac
ctgatcgacaaggacgaatatccgcagacggcggagctggaacgccgctgtgtggccctg
ctggccgatctgtggcatgccccggccggcgccatcggctgctccaccatcggcagcagc
gaagcggccatgctcgggggcatggcggccaagtggcgctggcgtgcccgccagcaggcc
gccggccggcccacggacaagcccaacatggtgtgcggcagtgtgcagatctgctggcac
aagttcgcccgctactgggacatcgagctgcgcgagatcaccatggagcccggcaggctc
tgcctcaccgcggaggacgtgctcagccgggtggatgagaacacgatcctggtggtgccc
accctgggcgtgacttatcacgggctctacgaggatgtggccagcctcagtgccgccctc
gacggtctgcagcagcgctcaggcctcgacattcccatccatgtggatgcggccagtggg
ggctttctggcgcccttcaccgctcctcacctgccgccctgggatttccggctggagcgg
gtgaagtcgatcaacgcctcgggccacaagttcggcctcgggcccctgggggtgggctgg
gtgctgtggcgccaggccagtgatctccccagcgagctcgtgttcaaggtgagctacctg
ggcggcgacatgcccaccttccagatcaacttctccaggcccgccggccaggtgatcgcc
cagtactacacctttgtgcagctgggtcgtgagggctaccgccgcatccatgccgtgtcc
cacgccgtggcgcaggtggtggcggcggcgctgcaggcgatgccgctgttcgaggtgctg
cacgatggcaatccccatcgcggcatccctgccgtggtgtggcgtctggctccggggcag
gatcccggcttcagcctgtacgacctggccgaccggctgcgggtgcgtggctggcaggtg
ccggcctaccccctcaccggcagcctcgccagtacccccttccagcgcatcctggtgaag
cggggcttcacccgcgagatggccgacctgctggtggaggacatccgccaggcggtggac
catctccacaaccacccgcgggccgtgccgctctccgccgaggaagcggcgtcctacaac
catctgtga

DBGET integrated database retrieval system