KEGG   Cyanobium sp. NIES-981: CBM981_2756Help
Entry
CBM981_2756       CDS       T04888                                 

Definition
(GenBank) putative Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBM981_2756
   00020 Citrate cycle (TCA cycle)
    CBM981_2756
   00620 Pyruvate metabolism
    CBM981_2756
Enzymes [BR:cyi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBM981_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(2510890..2512245)
Genome map
AA seq 451 aa AA seqDB search
MPALSSTMTEGKIVEWLKQPGERVERGESVLVVESDKADMDVEAFQEGFLAAVLMPAGGT
APVGETIGLIVETEEEIAAAAAAAPAAPAAATPAPAAATPAAAAAPAAPSPVPAPAPAPV
AAAPAPAPAAAPTVTVPVSAPAPSAGGRVVATPRAKKLAGQLGVDLGALRGSGPHGRIQA
EDVLAATGQPISVPRVAEGSAPAAAAGGNGASAPAPAPAGQTFGRPGEAVAFNTLQNAVN
RNMLASLAVPTFRVGYTITTTKLDAFYKQVKSKGVTMTALLAKAVAVTLARHPQVNAATS
ADGSAMAYPAAVNVAVAVAMEDGGLITPVLASADKTDIYALARSWADLVARARSKQLQPE
EYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPCVVAGKDGSIRVANQMQVNLT
CDHRTIYGAHAAAFLKDLAQLIETNPESLAL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctctcctccacgatgacggagggcaagatcgtggagtggctcaagcagccc
ggtgagcgcgtcgagcgcggcgagtccgtgctggtggtggagagcgacaaggccgacatg
gatgtggaggccttccaggagggttttctcgccgcggtgctgatgccggctggtggcacc
gctcctgtgggtgagacgatcggcctcatcgtggaaaccgaggaggagatcgctgccgcc
gctgccgcggcacccgcagcccctgccgcggccactccggcaccggccgccgcaaccccc
gccgccgccgctgcgccggcggccccctcgccggttccggctcccgccccggcccctgtc
gctgcggccccggcacccgctccagccgccgctccaaccgtgacggtcccggtgagcgcc
ccggcgcccagtgccggggggcgggtggtggccacgccccgggcgaagaagctggccggc
cagctgggcgtggatctgggcgccctgcgcggcagcggtccccatggccgcatccaggcc
gaggacgtgctggccgccaccggccagcccatcagcgtgccccgggtggccgagggatcg
gcgccggctgccgctgccggcggcaacggtgccagtgcgccggcgccggcccccgccggc
cagaccttcggccgccccggcgaggccgtggccttcaacaccctgcagaacgcggtcaac
cgcaacatgctggccagcctggcggtgcccaccttccgggtgggttacacgatcaccacc
accaagctcgacgccttctacaagcaggtgaagagcaagggcgtcaccatgacggcgctg
ctggccaaggccgtggccgtcaccctggcccgccatccccaggtgaacgccgccacctcc
gccgacggcagtgccatggcctaccccgcggccgtgaacgtggccgtggccgtggcgatg
gaggacggcggcctgatcacgcccgtgctggccagcgcggacaagaccgacatctacgcc
ctggcccgcagctgggccgatctggtggcccgggcccgcagcaagcagctgcaaccggag
gagtacagcaccggcaccttcaccctcagcaatctgggcatgttcggcgtggatcgcttc
gatgcgatcctgccccccggcaccggcgccatcctggcggtggccgcctcccgcccctgc
gtggtggccggcaaggacggatcgatccgggtggcgaaccagatgcaggtgaacctcacc
tgcgaccaccgcaccatctacggggcccatgccgccgccttcctcaaggacctggcccag
ctgatcgagaccaaccccgagagcctggccctctga

DBGET integrated database retrieval system