KEGG   Cyanothece sp. PCC 7822: Cyan7822_2645Help
Entry
Cyan7822_2645     CDS       T01310                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7822_2645
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_2645
   00680 Methane metabolism
    Cyan7822_2645
Enzymes [BR:cyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyan7822_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2946253..2949315)
Genome map
AA seq 1020 aa AA seqDB search
MSSLVQVPTTPLQFFSTSDLFLQARLKLVEDLWEAVLKAECGQDLVDLLIKLRAICSEQG
QAQKALEDSITQLIEKLDLNEAVRTSRAFALYFQLINIVEQHYEQRDQQLSRRATYNEGE
SSAKNGINGEQTSIFSSAFGANWLERSLNDEKQNDQKIGTFHWLFPYLKQLNVPPQQIQR
LLEQLDVRLVFTAHPTEIVRHTIRRKQRRIAHILQKLDQAEETFRGMGLTNSWEAEEAKE
QLKEEIRLWWRTDELHQFKPTVLDEVDYSLHYFNEVLFEAIPQLALRLKRTLKSAFPRLR
PPKNNFCYFGSWVGGDRDGNPFVTPEVTWATACYQRNVVIEKYIERVDELSNILSPSLHW
CNVLPDLLDSLEKDRVQIPQVYNQLAIRYRQEPYRLKLAYIKKRLENTRDRNSRLANPEE
RLLVFKTTNANNYQNKEEFIEELKLMRRNLESTGLSCQELDSLICQVEVYGFNLTQLDFR
QESSNHSDAINEIAEYLQILPKPYNQLTEAERTAWLIEELKTRRPLIPQEMPFSEKTCEV
IETLRMLRQLQQEFGLEICHTYIISMTNEVSDVLEVLLLAQEAGLYDPATCSSTIRIVPL
FETVEDLKRAPEIMRALFELTLYRATLAGGYDHLASLQGENVGELKPPLLEPTNLQEIMV
GYSDSNKDSGFLSSNWEIHKAQKALQKVAKRYGLDLRLFHGRGGSVGRGGGPAYAAILAQ
PTATVNGRIKITEQGEVLASKYSLPELALYNLETIVTAVIQSSLLGCGFDDIQVWNEIME
ELASCSRKAYRALIYEEPDFVDFFMSVTPIQEISQLQISSRPARRKSGKKDLSTLRAIPW
VFSWTQTRFLLPAWYGVGTALEQFISTEPEEHLKLLRYFYLKWPFFKMVISKVEMTLSKV
DLQIAYHYVKELSQPEDRERFERLFEQIAQEYHRTCRLVLEITENKRLLDGDPTLQRSVQ
LRNGTIVPLGFLQVSLIKRLRQYNAQAESGVINFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgctagttcaagtccccacaaccccattacaattcttctccacatcagactta
tttttacaagctagactaaaattagtcgaagatttatgggaagccgtgctaaaggcagaa
tgcgggcaagatttggtggatctgctcataaaactgcgtgcaatttgttctgaacaagga
caagcccaaaaagcgttagaagactccattacccaattgattgaaaaactcgacctcaat
gaagcagtaagaacgtctcgcgcttttgctctctatttccaactcattaatattgttgaa
caacactacgaacaacgagaccaacaactctcacgacgggccacctacaatgaaggagag
tccagtgccaaaaatggcattaacggcgagcaaaccagtatattctcctcggcatttgga
gcaaattggttagaaagaagtttgaacgatgaaaaacaaaatgatcaaaaaataggaact
tttcactggctatttccctatttaaaacaattaaatgttccacctcaacaaattcaacgc
ctactcgaacaactagatgtgcgcctggtttttacagcccatcccaccgaaattgttcgc
cacaccattcgacgcaaacaacggcgtatcgctcatattttacaaaagttagaccaggca
gaagaaacctttagaggaatggggctaaccaactcctgggaagcagaagaagctaaagaa
cagcttaaagaagaaattcgcctctggtggcgtaccgatgagttacaccagtttaaaccc
accgtgttagatgaagtggactactccctacactattttaatgaagtcctctttgaggca
attcctcaattagcccttcgtctcaaacgaactctaaaaagtgccttccccagactacgc
ccaccgaagaataatttctgttattttggctcttgggtgggaggcgatcgagatgggaac
ccctttgttacaccagaagtgacttgggccacggcctgttatcaacgcaatgtcgttatc
gaaaaatatatcgaaagggtagatgagttatcgaatatccttagtccttccctccattgg
tgtaacgtcctgccggatttgttagactccctagaaaaagaccgcgtacaaatcccacaa
gtttataatcagttagccattcgttaccgtcaagaaccctatcgtcttaagttagcttat
attaaaaaacgcctggaaaatacccgcgaccgcaatagccgcctagctaacccagaagaa
cgccttttagtgttcaagacaaccaacgccaacaattaccaaaataaagaagagtttata
gaagaactcaaattaatgcggcgtaacctagaaagcactggcttaagttgtcaagaatta
gatagcttaatttgtcaggtagaagtttatgggtttaacctcacgcaactagatttccgc
caagagtcgagtaaccactcagatgcgatcaacgaaatagcagaatatttacaaattctg
cctaaaccctacaaccaactgactgaagccgaaagaaccgcctggttaatcgaagaatta
aaaactcgtcgtcctctcattccccaggaaatgccgttttctgagaaaacctgcgaagtg
atagaaaccttgaggatgttgcggcagctacaacaagaatttggtttagagatctgtcat
acctacattatcagtatgactaatgaggtcagcgatgtcttagaggttcttctcttggca
caagaagccggactctatgacccggccacttgttccagcacgatccgcattgtaccccta
tttgaaaccgtagaagaccttaaacgggcacccgaaatcatgcgggcgctatttgaattg
actctttaccgcgccactttggcaggaggatatgatcatttagcctctttacagggggaa
aatgtgggcgaacttaaaccccccctcttagaacccactaacctacaagaaattatggtc
ggttattccgacagtaacaaagattctgggtttttaagcagtaattgggagattcataaa
gcccaaaaagctttacaaaaagtcgctaaaagatatggcttagatttacgcctgtttcac
ggacgcgggggttcagtaggacgaggcggtggacccgcttatgccgctattctcgctcaa
ccgacagcgacggttaatggcagaattaaaattactgaacagggagaagtcctcgcttct
aaatattctctccctgaattagccctttataacctagaaaccattgttactgccgttatt
caatcgagtttgttaggctgcggctttgatgatattcaggtttggaatgagatcatggaa
gaactcgccagttgttctcgtaaagcctatcgtgccttgatttatgaagaaccggatttt
gtggatttcttcatgtctgtcacccccattcaagaaattagtcaactccaaattagttct
cgcccggctagacgtaaaagtgggaaaaaagacctcagtaccctacgcgcaattccttgg
gtctttagttggactcaaacccgttttctgttacccgcttggtatggggtaggaaccgct
ttagaacagtttattagcaccgaacctgaagaacatttgaaactgttgcgctatttttat
ctcaaatggcccttctttaaaatggtcatctcaaaagtggaaatgaccttatctaaggta
gatttgcaaattgcctatcattatgtaaaggaattgtctcaaccggaagatagagaacgc
tttgagcggctgtttgagcaaatagcccaagaatatcatcgcacttgccgcttagtctta
gaaattaccgagaataaacggctcctagatggcgatcccaccttacagcgttctgttcag
ttacgcaatggaacaattgttcctctaggatttttgcaagtatctctcatcaaacgccta
cgtcagtacaacgcacaagctgagtctggagtcattaatttccgttattctaaggaagag
ttgctcagaggagcgctattaaccattaatggaattgcggcaggaatgagaaataccggt
tga

DBGET integrated database retrieval system