KEGG   Cyanothece sp. PCC 8801: PCC8801_2254Help
Entry
PCC8801_2254      CDS       T00806                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC8801_2254
   01230 Biosynthesis of amino acids
    PCC8801_2254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_2254
   00620 Pyruvate metabolism
    PCC8801_2254
  Nucleotide metabolism
   00230 Purine metabolism
    PCC8801_2254
Enzymes [BR:cyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     PCC8801_2254
Exosome [BR:cyp04147]
 Exosomal proteins
  Proteins found in most exosomes
   PCC8801_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2326335..2327753
Genome map
AA seq 472 aa AA seqDB search
MKPLNFRTKIVATIGPASNTPEVLRQMLLAGVNVARLNFSHGSYEDHAQMVKLLRSLSEE
LDLPLTILQDLQGPKIRVGKLPPDGLNLIEGQSLTLVPLAAWKNQANTVGIDYPYVAEEA
QPGTQVLLDDGLLELTVEQVKGNEVICQVVEGGILKSNKGVNLPTLNLRLPSMTEKDKKD
LEFGLSQGVDIISLSFVRKPEDIQELKEFIAQRSAKVPVLAKIEKPQAVDNIEAIIDECD
AIMVARGDLGVEMRPEKVPGIQKRIIKLCNQKGIPVITATQMLDSMIRNPRPTRAEASDV
ANAIIDGTDAVMLSGESAIGDYPVQAVQMLANIAKDIEPGLNFANYPPRRQNKAHAIAEA
LNTIDKILDLQCIVTFTETGYSAKLAAAERPRVPIVALTPDQQVYHRLNLVWGVRPILFD
YDESSLDDLMVKVENMLKIRNYATSGDQVLIMGGLPLRKASTTSFLDIHTIT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccttaaattttcggactaaaattgttgctactatcggtcctgcgagtaatact
cccgaagtattacgtcaaatgctcttagccggagtcaatgttgcgcggttgaatttttcc
cacggtagctacgaagatcacgctcagatggttaaactcttacgttctttgtccgaagaa
ttagacttacccctgaccattttacaagaccttcaaggtccaaaaattcgggtaggcaaa
ttacccccagacggacttaacctcatcgaaggacaatctctaaccttagttcctcttgct
gcttggaaaaatcaagccaataccgttggcattgattatccctacgtcgctgaagaagcg
caacccggtactcaagtgctgcttgatgacggtttattggagttaaccgttgaacaagtc
aagggaaatgaggtcatctgtcaagtggttgaaggaggcattctcaaaagcaataagggg
gttaatttgccaacccttaatctacgcttgccttccatgaccgaaaaagataagaaagat
ctcgaatttggactatcccaaggcgttgacatcatttccctaagctttgtccgcaaaccc
gaagatattcaagaactcaaggaatttattgcccaaagatcggcaaaagttcccgtttta
gcgaaaattgaaaagccccaagccgttgacaatattgaagccattatcgatgaatgcgat
gctattatggttgcgcggggagacttaggggtagaaatgcgccccgaaaaggttccaggt
atccaaaaacgcatcattaagctgtgtaaccaaaaaggcatccccgttattaccgccacc
cagatgctcgatagcatgattcgtaacccccgtcccacccgtgctgaagccagtgacgta
gccaatgctatcattgatggaaccgatgcggttatgttatcaggagaatcagcgatcgga
gattatcccgtgcaagcggtgcaaatgctggctaatattgccaaagatattgaaccagga
ctgaattttgccaattatcctcctcgacggcagaataaagcccacgccatagccgaagct
ctcaataccatcgacaagattcttgatttacaatgtattgtcacctttacggaaaccggg
tattctgctaaattagctgctgctgaacggccacgggttcccatagtggctttaacacct
gatcagcaagtttatcatcgccttaatttagtttggggagtccgacccattttatttgac
tacgatgagtcttccctagatgacttgatggttaaagtagaaaatatgttaaaaatccga
aactacgcgacatcaggggatcaagtgttgattatgggtggtttacccctcagaaaagcc
agtaccacgagttttctcgatattcatacgattacttaa

DBGET integrated database retrieval system