KEGG   Cyanothece sp. ATCC 51142: cce_2957Help
Entry
cce_2957          CDS       T00686                                 

Gene name
gst2
Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    cce_2957 (gst2)
Enzymes [BR:cyt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     cce_2957 (gst2)
Transporters [BR:cyt02000]
 Other Transporters
  Pores ion channels [TC:1]
   cce_2957 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
2997829..2998542
Genome map
AA seq 237 aa AA seqDB search
MSATCVINGWERPEKTPMLKLYHLPISFNSRRVWIALLEKGLSFELIPMKLNGDQLTPEF
LALNPFHHIPVLVDEAFSLFESLAILDYLEAKYPTPSLVPSDPQGLGTVKMINLVTLNEL
LPATTPLIQHSMGFITLDEQRIANTKEKVAVVLNFFETSLGDRSYIVGNTLTLADIVAGT
MVGFLPQMGVSLSAYPQLTAWTKQLSQRESWQQTEPQPEEIDKFRETMKKLMAQRGS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctacttgtgtcattaatggttgggaaaggccagaaaagacacccatgttaaaa
ctctatcatttgccgatttcctttaattctcgtcgtgtttggattgctttactggaaaaa
ggattatcgtttgagttaattcccatgaaactcaacggcgatcaactaactccagaattt
ttagcccttaacccttttcatcacatccctgtcctggtggatgaagcgtttagcctcttt
gaatccctggctatcttagattatctcgaagcgaaatatcccaccccttccctagttcct
agcgacccccaaggattagggacagttaagatgattaacttagtgaccctgaatgaatta
ttaccagcaacaaccccattaattcagcatagtatgggatttattaccctagacgaacag
aggatagccaacactaaagaaaaagttgctgtcgttctcaacttttttgagacatctctc
ggcgatcgctcctatatagttggcaataccttaacgttggctgacattgtagcaggaaca
atggtggggtttctgcctcagatgggtgtttctttatctgcctatcctcaattaaccgct
tggacaaagcaattaagtcaacgggaaagttggcaacaaacggaaccccaaccagaagaa
attgacaaatttcgagaaaccatgaagaaattaatggctcaacgtggttcttaa

DBGET integrated database retrieval system