KEGG   Cycloclasticus sp. PY97N: CPC19_05585Help
Entry
CPC19_05585       CDS       T05126                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPC19_05585
   00620 Pyruvate metabolism
    CPC19_05585
   00630 Glyoxylate and dicarboxylate metabolism
    CPC19_05585
  Energy metabolism
   00680 Methane metabolism
    CPC19_05585
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CPC19_05585
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CPC19_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1120285..1121262
Genome map
AA seq 325 aa AA seqDB search
MKAPVHVAVTGAAGQISYSLLFRIASGDFLGPDQPICLHLLEITPALGALEGAVMELNDC
AFPLLQSVSMSDDAEVAFKDIDFAFLVGARPRGPGMERKDLLEANAAIFSVQGKALNKVA
KRDVRVLVVGNPANTNALIAMNNAPDLDPRNFTAMTRLDHNRAMSLLAEKTGNHNTDVTK
MTIWGNHSATQYPDLHNCLINGEDALSKVDASWYADDFIPAVQQRGAAIIKARGLSSAAS
AASSALDHMRTWVQGTADGDWVSMGIPSDGSYGIEEGLIYSFPVTVKDGDYSIVQGLEIN
DFSRERMIATENELKEERDGVKHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacctgttcatgtagccgttaccggcgccgctggtcaaatttcgtactcatta
ttatttcgtatagcatctggcgactttttaggcccagatcagccaatttgtttacaccta
ttagaaatcacacctgctttaggtgcgcttgagggtgcggttatggaattgaacgattgt
gcatttcctttattacaaagtgtttcaatgtctgatgatgctgaagttgcctttaaagat
atcgattttgcattcttagtaggtgctcgtccacgtggtcctggtatggaacgtaaagac
ttgttggaagcaaatgcggccatcttttcggtacaaggtaaagccttaaataaagttgct
aaacgtgatgttcgtgtattagtggtgggtaaccctgcaaatacaaatgcattgattgcg
atgaataatgcaccagaccttgacccacgtaacttcacagcaatgacacgtttagaccat
aatcgtgcgatgagcttattggccgaaaaaacgggtaatcataatacggacgttactaag
atgacaatctggggcaaccactcagcaacacaatacccagaccttcacaattgcttaatc
aacggtgaagatgcgttatctaaggtcgatgcaagctggtatgccgatgactttattcct
gctgttcaacaacgtggcgctgccattattaaagcacgtggcttgtcaagcgcagcgtct
gctgccagttctgcattagaccatatgcgtacttgggtgcaaggaacagcagacggcgat
tgggtgagtatgggaattccaagtgatggaagctatggtattgaagaaggtttaatttac
tcattccctgtgactgttaaagacggtgactattcaatcgttcaaggtcttgaaattaat
gattttagtcgtgaaagaatgatcgcaacggaaaatgagcttaaagaagaacgtgatggt
gtaaagcacctgctttaa

DBGET integrated database retrieval system