KEGG   Defluviimonas alba: AKL17_0408Help
Entry
AKL17_0408        CDS       T04387                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
daa  Defluviimonas alba
Brite
Translation factors [BR:daa03012]
 Eukaryotic Type
  Elongation factors
   AKL17_0408
 Prokaryotic Type
   AKL17_0408
Mitochondrial biogenesis [BR:daa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AKL17_0408
Exosome [BR:daa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AKL17_0408
  Exosomal proteins of breast cancer cells
   AKL17_0408
  Exosomal proteins of colorectal cancer cells
   AKL17_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
401669..402844
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGDFRAYDQIDGAPEERARGITIST
AHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCAASDGPMPQTREHILLGRQ
VGIPFMVCYMNKIDLVDDEELVELVEMELRELFSSYEYPGDDIPIIKGSAHQAMIGERKD
IGEDSIRALLKAVDEYIPTPARAIDQPFLMPIEDVFSISGRGTVVTGRIERGVINVGDEV
EIIGIKATQKSVCTGVEMFRKLLDRGEAGDNVGVLLRGIDREAVERGQVLCKPKSVNPHT
HFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVKLPEGTEMVMPGDNLKFEVEL
IAPIAMEEKLRFAIREGGRTVGAGVVSKILK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaagtttgaacggaacaaaccgcacgtcaacatcggcacgattggccac
gttgaccacggcaagacgactctgacggcggcgatcacgaagtatttcggcgacttccgg
gcctatgaccagatcgacggtgcgccggaagagcgtgctcgcgggatcacgatctcgacg
gcgcatgtggaatacgagaccgagaaccggcactatgcgcatgtggactgccccggccac
gccgactatgtgaagaacatgatcaccggcgcggcgcagatggacggcgcgatcctggtc
tgtgcggcctcggacgggccgatgccgcagacgcgcgagcacatcctgctcggccgccag
gtcggcattccgttcatggtgtgctacatgaacaagatcgacctggtggatgatgaagag
ctggtcgagctggtggagatggaacttcgcgagctgttctcgtcctacgaataccctggc
gacgacatcccgatcatcaagggctctgcgcaccaggcgatgatcggcgagcgcaaggat
atcggcgaggattcgatccgggcgctgctgaaggcggttgacgagtacatcccgacgccg
gcgcgtgcgatcgaccagccgttcctgatgccgatcgaggacgtgttctcgatctcgggg
cgcggcacggttgtgaccgggcggatcgagcgcggtgttatcaacgtcggcgacgaggtc
gagatcatcgggatcaaggcgacgcagaaatcggtctgcaccggggtcgagatgttccgc
aagctgctggaccgcggcgaggctggcgacaacgtgggcgttctgctgcgcggcatcgac
cgtgaggcggtggaacgtgggcaggtgctgtgcaagccgaaatcggtgaacccgcacacg
catttcgaagccgaggcctatatcctgaccaaggaagagggcggccgccacactccgttc
ttcgccaactaccgcccgcagttctacttccgcacgaccgacgtgaccgggaccgtgaaa
ctgccggaaggcaccgagatggtgatgccgggcgacaacctgaagttcgaggtcgaactg
atcgccccgatcgcgatggaagaaaaactgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgcaggcgtcgtgtcgaaaatcctgaagtaa

DBGET integrated database retrieval system