KEGG   Defluviimonas alba: AKL17_1178Help
Entry
AKL17_1178        CDS       T04387                                 

Definition
(GenBank) superoxide dismutase protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
daa  Defluviimonas alba
Brite
Enzymes [BR:daa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AKL17_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AMY68434
UniProt: A0A159Z2U0
LinkDB All DBs
Position
complement(1156187..1156747)
Genome map
AA seq 186 aa AA seqDB search
MLRTAIPAALLTASFALPAAAQQAPAQETPTVPAPDMPAAAASFIDATGSQIGSATLTGT
PHGVLIGLEIDGLPAGKWVAFHIHEGETCEHDHRFDSAGGHLNLTGTDHGYFNDTGPHSG
DMPNQYVASDGLLKAEVFNGYVSLDGGPTSVLGKTLMIHAEPDDYVSQPAGAAGERLACA
VIEAAS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaccgccatccccgccgcgctgctgaccgccagcttcgccctgccagccgcc
gcccagcaggcccccgcacaggaaacccccaccgtccccgccccagacatgcctgccgct
gccgccagcttcatcgacgccacgggcagccagatcggcagcgccaccctgaccggcacc
ccgcatggcgtgctgatcgggttggagatcgacgggcttccggccggaaaatgggtcgcc
ttccacatccacgagggcgagacctgcgagcatgaccaccgcttcgactccgccggcggc
cacctgaacctgaccggcaccgatcacggctatttcaacgacaccggcccgcattcgggc
gacatgcccaaccagtatgtcgcctccgacgggctgctgaaggccgaggtgttcaacggc
tatgtcagtctcgacggcggcccgaccagcgttcttggcaagaccttgatgatccatgcc
gagcctgacgattacgtcagccagcccgccggtgccgccggcgaacggcttgcctgcgcg
gtgatcgaagccgcatcgtaa

DBGET integrated database retrieval system