KEGG   Deinococcus actinosclerus: AUC44_02740Help
Entry
AUC44_02740       CDS       T04259                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dab  Deinococcus actinosclerus
Pathway
dab00010  Glycolysis / Gluconeogenesis
dab00020  Citrate cycle (TCA cycle)
dab00620  Pyruvate metabolism
dab01100  Metabolic pathways
dab01110  Biosynthesis of secondary metabolites
dab01120  Microbial metabolism in diverse environments
dab01130  Biosynthesis of antibiotics
dab01200  Carbon metabolism
Module
dab_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AUC44_02740
   00020 Citrate cycle (TCA cycle)
    AUC44_02740
   00620 Pyruvate metabolism
    AUC44_02740
Enzymes [BR:dab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AUC44_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N PYNP_C HlyD_3 NQRA PTS_EIIA_1 DUF2254
Motif
Other DBs
NCBI-ProteinID: ALW87948
UniProt: A0A0U4AIB5
LinkDB All DBs
Position
574829..576553
Genome map
AA seq 574 aa AA seqDB search
MATELKLPDVGDNIEQGTVVTVLVKAGDSVTEGQPIIEIETDKAVIEVPAEAAGTVEAVN
VTVGDTVKVGGVIATLSGGSAPAAPAAPASGPVDEAEVGSSKAVAQAQQDAQKEQAGEAA
APATPSAAASAGGQITLPDVGDNIEQGTVVSVLVKEGDTVSEGQPVIEIETDKAVVEVPA
NAGGTVTGVNVKVGDTVKVGGVIATLGGASAPAAPASAPAPAAAAPAASTPASAPTVVKV
NISGGEQPAAQFPKSQGTQNPQTFDGRTVVAAAPSVRRLARELGVDIHAVHGTGIAGRIS
EEDVRRTGGTPTVTAPAAAPAASAPAAAPAVAAAPLPDFTKWGSVTREDMSGIRKATVRS
MTASTAIPMVTHFDKADVTVMEEVRKRFGARVEKAGGKLTMTHILMKVVANALRKFPKFG
ASLDLDAQQVIYKDFVNIGVAVDTPVGLLVPVVKDADRKSITDLVLELSELAGKARDRKL
KPDEMQGATFTISNLGGIGGHAFTPIVNSPEVAILGVSRGGMEPVWNKEKGEFEPRNMLP
LSLTYDHRLIDGADAARFVRFICESLEDPFLISL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaactgaaactgcccgacgtgggcgacaacattgagcagggcacggtcgtg
acggtgctcgtgaaggccggggacagcgtgaccgagggccagccgatcatcgagatcgag
accgacaaggccgtcatcgaggtgcccgccgaggccgccgggaccgtggaggccgtgaac
gtgaccgtgggcgacaccgtgaaggtcggcggcgtgatcgccaccctgagcggcggcagc
gccccggccgcccccgccgctccggccagcggcccggtcgacgaggctgaggtcggcagc
agcaaggcggtcgcgcaggcgcagcaggacgcgcagaaagaacaggccggtgaggccgcc
gcgcccgccaccccttccgctgccgccagcgccggcgggcagatcaccctgccggacgtg
ggcgacaacatcgagcagggtaccgtcgtcagcgtcctcgtgaaggaaggcgacaccgtc
agcgagggccagcccgtcatcgagatcgagacggacaaggccgtcgtggaagtccccgcc
aacgcgggcggcaccgtgaccggcgtgaacgtgaaggtcggtgacaccgtgaaggtgggc
ggcgtgatcgccaccctgggcggcgccagcgcccccgccgcaccggccagcgcgcccgcc
ccggcagccgctgccccggcagcctccacgccggccagcgcccccaccgtcgtgaaggtg
aacatcagcggcggcgagcagcccgccgcgcagttccccaaatcacagggcacccagaac
ccccagaccttcgacggccgcaccgtcgtggccgccgcgcccagcgtccgccgcctcgcg
cgggaactcggcgtggacatccacgccgtgcacggcaccggcatcgcgggccgcatcagc
gaggaggacgtgcgccgcaccggcggcacccccaccgtcaccgcgcccgccgccgccccg
gccgccagcgcccccgcagccgcgcccgccgtggccgccgcgccgctgcccgacttcacg
aagtggggcagcgtcacccgcgaggacatgagcggcatccgtaaggccaccgtccgctcc
atgaccgccagcaccgccatccccatggtcacgcacttcgacaaggccgacgtgaccgtc
atggaagaggtccgcaaacgcttcggcgcgcgcgtggagaaggcgggcggcaagctcacc
atgacccacatcctcatgaaggtcgtcgcgaacgccctgcgcaagttccccaagttcggc
gcgagcctcgacctggacgcccagcaggtcatctacaaggacttcgtgaacatcggcgtc
gccgtggacacgcccgtcggcctgctcgtgcccgtcgtcaaggacgccgaccgcaagagc
atcaccgacctcgtcctcgaactgagcgaactggccggcaaggcccgcgaccgcaaactg
aaacccgacgagatgcagggcgccaccttcacgatcagcaacctcggcgggatcggcggg
cacgccttcacgcccatcgtgaacagccccgaagtcgccatcctcggcgtgagccgcggc
ggcatggaacccgtctggaacaaggagaagggcgagttcgaaccccgcaacatgctcccc
ctcagcctcacctacgatcaccgcctgatcgacggcgccgacgccgcccgcttcgtccgc
ttcatctgcgaaagcctggaagaccccttcctgatctcgctgtaa

DBGET integrated database retrieval system