KEGG   Deinococcus actinosclerus: AUC44_03110Help
Entry
AUC44_03110       CDS       T04259                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dab  Deinococcus actinosclerus
Pathway
dab00020  Citrate cycle (TCA cycle)
dab00270  Cysteine and methionine metabolism
dab00620  Pyruvate metabolism
dab00630  Glyoxylate and dicarboxylate metabolism
dab00680  Methane metabolism
dab01100  Metabolic pathways
dab01110  Biosynthesis of secondary metabolites
dab01120  Microbial metabolism in diverse environments
dab01130  Biosynthesis of antibiotics
dab01200  Carbon metabolism
Module
dab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dab_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AUC44_03110
   00620 Pyruvate metabolism
    AUC44_03110
   00630 Glyoxylate and dicarboxylate metabolism
    AUC44_03110
  Energy metabolism
   00680 Methane metabolism
    AUC44_03110
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AUC44_03110
Enzymes [BR:dab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AUC44_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ALW88012
UniProt: A0A0U4AIH6
LinkDB All DBs
Position
complement(648092..649084)
Genome map
AA seq 330 aa AA seqDB search
MTTKQPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEITPALKALNGVVMELR
DCAFPLLADIVTSDDPMVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQGEALNA
VASRDVKVLVVGNPANTNALIAQQNAPDLDPKQFTAMVRLDHNRAISQLAEKTGKPVSSI
KNLTIWGNHSSTQYPDLSQATVDGQPALDQVDRDWYEQQYISTVAKRGAAIIEARGLSSA
ASAASAAIDHMRDWALGTPEGEWVSMGIPSDGSYGIPEGLIYGFPVTCKDGQYEIVQGLP
VSNFSRGKMDATAQELTEERDEVRKLGLVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaaacaacccgtccgcgttgccgttaccggcgccgctggccagatcggctac
agccttcttttccgcatcgcgtcgggcgacatgctcggcaaggatcagccggtcattctg
cagctgctggagatcacgcccgcgctgaaggcgctcaacggcgtcgtgatggagctgcgt
gactgcgcgttcccgctgctggcggacatcgtgacgagcgacgatccgatggtggcgttc
aaggacgcggattacgcgctgctggtgggcgccatgccccgcaaggccgggatggagcgc
ggggacctgctgggcgcgaacggcgggatcttcaagccgcagggtgaagcgctgaacgcc
gtggcgagccgggacgtgaaggtgctcgtggtgggcaaccccgcgaacacgaacgcgctg
atcgcgcagcagaacgcgccggatctggatccgaagcagttcacggcgatggtgcgcctg
gatcacaaccgcgcgatcagccagctggcggagaagaccgggaagcccgtgagcagcatc
aagaacctgacgatctggggcaaccactcctcgacccagtaccccgacctgagccaggcg
acggtggacggccagcccgcgctggatcaggtggaccgcgactggtacgagcagcagtac
atctcgaccgtggcgaagcgtggcgcggcgatcatcgaggcgcgcggcctgagcagcgcc
gcctccgccgcgagcgccgcgatcgaccacatgcgcgactgggcgctgggtaccccggaa
ggcgagtgggtcagcatgggcattcccagcgacggcagctacggcattcccgagggcctg
atctacggcttccccgtgacctgcaaggacggccagtacgagatcgtgcagggtctcccg
gtgagtaacttcagccgcggcaagatggacgccacggcgcaggaactgaccgaggagcgc
gacgaggtgcgcaagctgggtctggtcaagtaa

DBGET integrated database retrieval system