KEGG   Delftia acidovorans: Daci_4756Help
Entry
Daci_4756         CDS       T00620                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5244714..5250083)
Genome map
AA seq 1789 aa AA seqDB search
MLSGQSAIAAAGQAPASLVEHLRGLAQQRPDDIWLTVAAVQDGRVVERSHSYDEFDRRVR
ALAARLQQLCPVGARALVMMDNDEHYAASMLACFYAGVIAVPVPPLESLRVQHLERLLGI
VGDADAACVISTAEVMQALPGADARFAGIAAVAADQVDLADADAWRPHAPAADDIAFLQY
TSGSTSAPKGVMVSHGNLIANEAAIQQRMDIGAGDRFMSWAPLYHDMGLIGGLLQPLYSG
LPLVLTSPRLFLESPVRWLELISRHRATISGGPDFAYRMCLERIKPSQLAQLDLSSWRLA
YTGAEPVRADTVTAFAQRFAACGLRPDAAYACYGLAEASLFITGGSCGAGATITSFDTEA
LAQGRAEESPGASQTTSLVGCGPAVPGHAVAIVDPHSLQVLEPGHVGEIWAHGPSISQGY
WGKPQQTQQAFVEHAGRRWLRTGDLGFVHGGQVHVAGRIKDLIIVRGHNLYPQDIERVVE
AEVEAVRKGRVAAFAVDIDGREGIGIAAEVSFGMQKLVPAQALVDALSTAVGAQCGEAPT
VIVLLNPGALPRTSSGKLQRAACRQGWSARTLDAWAVFESGRFADGGSHAPQEAGAADPT
TGTLAGLWREVLGGDAQHGPAGEANFFAQGGNSLAAVRLAARICRQWSLEYPVGRVFEHP
RLRDQAQDIDRLCQQRQPGTALQRIAPLTEARRAMPLPLTPAQQRQWFLWKMDTRSTAYH
VQGALRITGPLDAGALRAAVQGLAERHGSLRTVFNARPDGEVEQRLDPQGRLELQWLDAA
QAAQGDSAQGDSAQREEHAAQWLQALCAQPFDLQQGPLARAALVRLQANEHILALVMHHI
VSDGASMQILLDDLAALYAGAPDSGPALQYVDYAVWQREQAQQAQQGQQASLAYWLERLQ
VPPGEAQPVLALPTDHPRQALARYRAGRHGFELSGATLQALRAQARQQGDTLFTLLLAGW
QALLYRYTGQEDIRVGVPVANRAHADLQGVVGFFVNTLVLRNRIDGRMRLADVLQQAREA
AQGAQAHHDLPFEQLVEALQPQRSLAHSPLFQVLFNHLVEDWHALQQVPGWTVAGQPLAA
ADAQFELTVEVRERSDGSLGISLVYARELFEPGSMQRLAAHYAAMLGALAHQPQCAVDEV
PLLGPDERQQLAAWSCNDQVLHGGDIVHRRFEQQVARSPGAPALCLGEATLGYAELNVRA
NQLAHHLIASGVRPGVPVGIAMERSIEMVVGLLAIMKAGAAYVPIDPEHPADRIAYMLED
SGVSLVLVQPQVRDRLPANCSAQLVDVPGLASRLQDMPAHNPAVALHGDSLVYVIYTSGS
TGRPKGAANRHRSLCNRLAWGQVHQPLGPGDTVLQKTPFGFDISFWEFFWPLTTGARLAL
AAPGDHRDPRRLAELIARHQVSTIHFVPSMLQAFMAHPAAATCQGLQRIICSGEALSAEL
QAAVLQAFPGTRLLNLYGPTEAAIEVTWWDCRDEGALSVPIGRPVAGLRTHVLDAALNEV
PRGVAGELYLGGVGLARGYWRRPGLSAERFVADPASRTGERLYRTGDLVRWRGDGQIDYL
GRVDHQVKIRGFRIELAEVEAQLLAHPAVREAVVVARQAADGARLAAFVSVQQGQTLDMA
ALRSALAAALPDYMLPSSITVLDALPLNANGKVDRKALPDAPALPALERQAYEPPEGGVA
ATIAALWAQVLGVERIGASDNFFDLGGHSLQLIRVHGLLESRLGRELSLVDLFKHPTVSA
LARRIEQGADGEGGGDGAAQAAAARDGMDAAQRRREALLQRKRHIERTL
NT seq 5370 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtggacaaagtgcaatcgcggcagcaggccaggcgccggccagcctggtcgag
catctgaggggcctggcgcagcagcggcccgacgacatctggctcaccgtggccgccgtg
caggacggccgcgtggtcgagcgcagccacagctatgacgagttcgaccgccgcgtgcgc
gcgctggccgcccggctgcagcagctgtgccccgtgggcgcgcgcgccctggtgatgatg
gacaacgacgagcactacgccgccagcatgctggcctgcttctacgctggcgtgatcgcc
gtgccggtgccgccgctggaatcgctgcgcgtgcagcatctggagcggctgctgggcatc
gtgggcgacgcggatgcggcctgcgtgatcagcacggccgaagtgatgcaggccctgccc
ggcgccgatgcgcgctttgccggcattgccgccgtggccgccgaccaggtggacctggcc
gatgccgacgcctggcggccccatgcgccggctgccgacgacatcgccttcctgcaatac
acctcgggctccacctcggcgcccaagggcgtgatggtcagccacggcaacctcatcgcc
aacgaggccgccatccagcagcgcatggacatcggcgcgggcgaccgcttcatgtcctgg
gcgccgctctaccacgacatgggcctgatcggcggactgctgcagccgctgtacagcggc
ctgccgctggtgctgacctcgccgcgcctctttctggaaagccccgtgcgctggctggag
ctgatctcgcgccaccgcgccaccatcagcggcggccccgacttcgcctaccgcatgtgc
ctggagcgcatcaagccgtcgcaactggcgcagctggacctgtcgagctggcggctggcc
tacacgggtgccgaacccgtgcgtgccgacaccgtcacggccttcgcgcagcgctttgcc
gcctgcgggctgcggcccgacgcggcctatgcatgctacggcctggccgaggccagcctg
ttcatcaccggcggcagctgcggcgcgggcgccacgatcacgtccttcgataccgaggcc
ctggcgcagggccgggccgaggaaagccccggcgcctcgcagaccacctcgctggtgggc
tgcggccccgccgttcccggccatgccgtggccatcgtcgatccgcacagcctgcaggtg
ctggagcccggccacgtgggcgagatctgggcgcacggccccagcatcagccagggctac
tggggcaagccgcagcaaacgcagcaggcctttgtcgagcatgcaggccggcgctggctg
cgcacgggcgacctgggcttcgtgcacggcgggcaggtccatgtggcgggccgcatcaag
gacctgatcatcgtgcgcgggcacaacctctacccgcaggacatcgagcgcgtggtcgag
gccgaggtcgaagccgtgcgcaaggggcgcgtggccgcgtttgcagtggacatcgatggc
cgggaaggcataggcattgctgccgaagtctcgttcggcatgcaaaaactggtgccggcc
caggccctggtcgatgccctgagcaccgccgtgggcgcgcagtgcggtgaggcacccacg
gtgatcgtgctgctcaaccccggcgccttgccccgcacctccagcggcaagctgcagcgc
gcagcctgccgccagggctggtccgcgcgcactctggatgcctgggcggtgttcgagtcg
ggccgctttgcggacggcggcagccacgcaccgcaggaggcgggcgcggcagatcccacc
acaggcacgctggccggcctgtggcgcgaggtgctcggtggcgatgcccagcacgggccg
gccggcgaggccaatttcttcgcgcaaggcggcaactccctggccgccgtgcggctggcc
gcgcgcatctgccggcaatggtccctggaatatccggtcgggcgggtcttcgagcacccg
cggctgcgcgaccaggcgcaggacatcgaccggctgtgccaacagcgccagccgggcacg
gcgctgcagcgcattgccccgctgaccgaggcccgccgcgccatgcccctgccgctgacg
ccggcccagcagcgccaatggtttctctggaagatggatacgcgcagcacggcctaccac
gtgcagggcgccctgcgcatcaccgggccgctggatgcaggcgccctgcgtgcggccgtg
cagggcctggccgaacggcacggttcgctgcgcacggtattcaacgcccggcccgatggg
gaggtcgagcagcgcctggacccccagggcaggctggagctgcagtggctggatgccgcg
caggccgcgcagggcgactccgcgcagggcgactccgcgcagcgcgaggagcacgccgcc
caatggctgcaggcgctgtgcgcccagccctttgatctgcagcaggggccgctggcccgg
gctgccctggtgcggctgcaggccaatgagcacatcctggcgctggtgatgcaccacatc
gtctccgacggcgcctccatgcagatcctgctggacgatctggcggcgctgtatgccggc
gccccggacagcggcccggcgctgcagtatgtggactacgccgtctggcagcgggagcag
gctcagcaggcccagcaaggccagcaggcctcgctggcctactggctggaacggttgcag
gtgcccccaggcgaggcccagcctgtgctggccctgcctaccgaccatccgcgccaggcg
ctggcacgctatcgggcgggacggcacggcttcgagctgtccggcgcgaccttgcaggcg
ctgcgcgcgcaggcccgccagcagggggacacgctcttcacgctgctgctggccggctgg
caggcgctgctgtaccgctacacggggcaggaggacatccgcgtcggcgtgcccgtggcc
aaccgcgcgcatgccgacctgcagggcgtggtcggctttttcgtcaacaccctggtgctg
cgcaaccgcatcgacgggcgcatgcgcctggctgacgtgctgcagcaggcccgcgaggcg
gcgcagggcgcccaggcccaccacgatctgccgttcgagcagctggtggaggcgctgcag
ccgcagcgcagcctggcgcacagccccttgttccaggtgctgttcaatcatctggtggag
gactggcacgcgctgcagcaggtgccgggctggacggtggccggccagccgctggcggcc
gcagatgcgcagttcgagctgaccgtggaagtgcgcgagcgctccgatggcagcctgggc
atcagcctggtctatgcccgcgagctgttcgagccgggcagcatgcagcgcctggccgcc
cactatgcggccatgctgggcgcactggcgcaccagccccaatgtgccgtggacgaggtg
ccgctgctgggtcccgacgaacgccagcaactggcggcctggagctgcaatgaccaggtc
ctgcacggcggcgacatcgtgcaccgccgcttcgagcagcaggtggcgcgcagccccggt
gccccggccctgtgcctgggcgaggccacgctgggctacgccgagctcaatgtgcgcgcc
aaccagctggcgcatcacctgatcgcatcgggcgtgcggcccggcgtgccggtgggcatt
gccatggagcgttccatcgagatggtcgtggggctgctggccatcatgaaggccggcgca
gcctatgtgcccatcgaccccgagcacccggccgaccgcatcgcctacatgctggaggac
agcggcgtgtccctggtgctggtgcagccgcaggtgcgtgaccgcctgccggccaactgc
agtgcccaactggtcgatgtgccgggcctggcgtcccggctgcaggacatgccggcccac
aacccggccgttgccctgcatggcgacagcctggtctatgtgatctacacctcgggttcg
accgggcggcccaagggcgcggccaaccgccaccgttcgctgtgcaatcgcctggcctgg
gggcaggtgcaccagccgctgggcccgggcgacacggtgctgcagaaaacgcccttcggc
ttcgacatctccttctgggaattcttctggccgctgaccaccggcgcacgcctggcgctg
gccgcccccggcgaccaccgcgatccccggcgcctggccgagctgatagcgcgccatcag
gtcagcaccatccacttcgtgccgtccatgctgcaggccttcatggcgcacccggcggcc
gccacctgccaggggctgcagcgcatcatctgcagcggcgaggccctgtccgccgaattg
caggcggccgtgctgcaggccttccccggcacccgcctgctcaatctctacggccccacg
gaggcggccatcgaggtcacctggtgggactgccgcgacgagggcgcgttgtccgtgccc
ataggccgccccgtggccgggctgcgcacccatgtgctggatgccgcgctcaacgaggtg
ccgcgcggcgtggccggcgagctgtatctgggcggtgtgggcctggcgcgcggctactgg
cggcggccgggcctgagcgccgagcgctttgtcgccgaccccgccagccgcacgggcgag
cgcctgtaccgcacgggcgacctggtgcgctggcgcggcgacggccagatcgactacctg
ggccgcgtggaccaccaggtgaagatccgcggctttcgcatcgagctggccgaggtggag
gcgcaactgctggcccaccccgccgtgcgcgaggccgtggtggtcgcccgccaggcggcc
gacggcgcgcggctggccgcctttgtctcggtgcagcaggggcagaccctggacatggcc
gcgctgcgcagcgcgctggccgcagccctgcccgactacatgctgccctcgtccatcacc
gttctggatgccttgccgctgaacgccaacggcaaggtggaccgcaaggcgctgcccgat
gcgcccgccctgccggccctggagcgccaggcctacgagccgcccgagggcggcgtggcc
gcgaccattgccgccctctgggcccaggtgctgggcgtggagcgcataggcgccagcgac
aacttcttcgacctgggcgggcattcgctgcagctcatccgcgtgcatggcctgctggag
tcgcggctgggccgggagctgtccctggtcgatctcttcaagcaccccacggtgtcggcc
ctggcgcggcgcatcgagcagggcgcagatggcgagggcgggggcgacggcgccgcgcag
gcggccgccgcccgggacggcatggacgcggcccagcgccgccgcgaggcgctgctgcag
cgcaagcgccacatcgaaaggaccctctga

DBGET integrated database retrieval system