KEGG   Desulfosporosinus acidiphilus: Desaci_0737Help
Entry
Desaci_0737       CDS       T02148                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desaci_0737
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Desaci_0737
Enzymes [BR:dai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desaci_0737
Peptidoglycan biosynthesis and degradation proteins [BR:dai01011]
 Precursor biosynthesis
  Racemase
   Desaci_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
766427..767548
Genome map
AA seq 373 aa AA seqDB search
MVRQAWAEVNLQALKDNYYKLQAYTQSEMMPIVKADAYGHGIIPVVKTLMNCGAKRFGVA
LLQEALELKAAFPKLDIMVIGAPEIDQWDTYVKEDIIPAIFNFSQARALSEAAVKLGRRA
RLHLKIDTGMSRIGFRDTDVSEIVKIGSLPSLFIEGIFTHFATADQKDLTFARQQLKRFE
ILFEKLKKAGLKIPIRHAANTAAILQFPEAHFELVRPGIGLYGLVPSSQVGAQVGLEPVM
SWKAKVSHFKKIKTGETVSYGRTFQAAYPTAVATIPLGYADGLRRALSNYGEMLIHGRRS
TMIGRICMDQTMLDVTKIPGVKVGDVVTILGKDGYEQITATEMAEWLGTISYEITCGISQ
RVPRIYLEPIGND
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgacaggcttgggctgaagttaatttgcaagctttaaaagacaattattacaag
cttcaggcgtatacacaaagtgaaatgatgcccattgtcaaggcggatgcttatgggcat
ggtattatcccggtggttaagaccctgatgaactgtggggcaaagcgctttggtgtggca
cttttacaagaggctttagaattaaaggcggcatttccaaagctggacatcatggttatt
ggtgccccggaaattgatcagtgggatacctatgttaaagaggatataataccggcaatt
tttaatttttctcaggcacgtgctctttcagaagcggctgttaaacttggccgaagagcg
aggctgcacttgaagattgatacaggaatgagccgcataggcttccgtgatactgatgtt
tctgaaatagtgaaaattgggtctttgccaagcttgtttattgaaggcatttttacccat
tttgccacagctgatcaaaaagatctcactttcgctcggcagcagcttaaacgttttgaa
attctctttgaaaagctcaagaaagcgggactgaaaattcctattcggcacgctgcaaac
actgcagccattttgcagtttccggaagcacattttgaacttgtacgtcccggcatcggt
ttatatgggctggttccatcgtctcaagtgggagctcaggttggcttggaaccggtaatg
tcttggaaagcgaaggtttctcattttaaaaagattaaaacgggagaaacggtgagttat
gggcgtacgtttcaggcggcctacccaacggctgttgcaacaattcctttgggatatgcc
gatggattgcgcagagcactttccaattatggcgaaatgctgattcatgggcggcgttcg
acgatgatcggccggatttgtatggatcagacaatgcttgatgtgactaaaatcccaggc
gtaaaagttggcgatgtggttacaattctggggaaagatggctacgagcagattactgcc
actgagatggccgaatggcttggaactattagttatgaaattacttgtgggatttcccag
cgagtccccaggatttatctggagccaattggaaacgattag

DBGET integrated database retrieval system