KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1860Help
Entry
DaAHT2_1860       CDS       T01244                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dak00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DaAHT2_1860
Enzymes [BR:dak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DaAHT2_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2154075..2155394)
Genome map
AA seq 439 aa AA seqDB search
MSDKSKPLVYVGMSADLVHPGHLNILREARKLGRVVVGLLTDQAIASYKRLPHMTFEQRK
EVVENLKGVDEVVGQETLDYVPNLRLIRPDYVVHGDDWRQGVQKQTRQRVIEALAEWGGE
LVEVPYTPDISSTQLNKSVKCFGITPGQRLGSLRRLIDAKPMVRLMEAHNGLTGLIVENL
FEQQEGRRLEFDGMWLSSLTDSTAKGKPDIEAVDVTSRMRTLSDIVEVTTKPILYDADTG
GRPEQFAFTVRTLERFGVSGAVIEDKIGAKRNSLFGAGVGQVQASLEEMADKIQVGNRAK
ITSTFMIIARIESLILEQGQEDALRRAHAYIDAGADGIMIHSRQKTVDEIAAFCAEYRKF
KKRVPLVAVPSSYNSVYDHELQEMGVDVVIYANHLLRSAYPAMLDTARSILLNGRSKEAD
DSLLSIKDILTLIPEGDWL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgataaaagtaaacccctggtgtatgtcgggatgagcgccgatctggtgcatccc
gggcatttgaatattctgcgtgaggcccgcaagctgggccgggtggtggtggggttgctt
accgaccaggccattgccagttacaagcggctgccgcacatgaccttcgagcaacgcaag
gaggtggtagaaaaccttaaaggcgtcgacgaagtggtgggccaggaaaccctggattat
gtccccaacctgcggttgatccgccccgactacgtggtgcatggtgacgactggcggcag
ggggtgcagaagcagacccgccagcgggtcatcgaggccctggccgaatggggcggcgag
ctggtggaagttccttataccccagacatttcctcgacccagctgaacaaaagcgtcaaa
tgcttcggcattacccccggccagcggctgggaagcctgcgccgcctgatcgacgccaag
cccatggtccgcctcatggaagcccacaacggcctcaccggcctgatcgtggaaaacctg
tttgagcagcaggaaggccgccgcctggagttcgacggcatgtggctttccagcctgacc
gactccaccgccaaaggcaagccggatatcgaagcggtggacgttacctctagaatgcgc
accttaagcgacatcgtggaggtcaccaccaagcccatcctgtacgatgccgacaccggc
ggccggcccgagcaattcgcctttacagtccgtaccctggagcgcttcggggtttccggc
gccgttatcgaagacaagatcggcgccaagcgcaactcgctgttcggggccggggtaggg
caggtgcaggcctcgctggaagagatggcagacaagatccaggtcggcaaccgggccaag
attacctctactttcatgatcatcgcccgcatcgaaagcctgatcctggaacagggccag
gaagacgccctgcgccgggcccatgcttatatcgacgccggcgccgacggcatcatgatc
cacagccggcagaaaaccgtagacgaaatcgccgccttctgcgccgagtaccggaaattt
aaaaaacgggtccccctggtggccgtaccatcgagctacaacagtgtttacgaccacgag
ttgcaggaaatgggggtggatgtggtaatctacgccaaccatctgctgcgcagcgcctac
ccggccatgctggacaccgcccgcagcatccttttaaacggccgctccaaagaggccgac
gacagcctgttgtccatcaaagatatccttactctcattccggagggcgactggttatga

DBGET integrated database retrieval system