KEGG   Drosophila ananassae: Dana_GF11769Help
Entry
Dana_GF11769      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dan  Drosophila ananassae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dana_GF11769
Enzymes [BR:dan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dana_GF11769
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dana_GF11769
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dana_GF11769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MATAEAQIGVNRNLQKQDLSNLEIGNLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIQKLLKSKHYRQQYDIQQLSRLRHLAERRRHSR
LRRLCSMPAPPPGHATDKRTNRRSSSQTSLSPSHSSGYGSAIGCEDHDTTHSSHKGSSVS
STSLKRRRSSGAQYTSTASAKRSKNNQGLVVKKPPKGEYVVERIEVVEVVQFKPVFFVKW
LGYDASNNTWESYENVADCAQLEEFVDRQLQLYEKYIAQITSELEEQLEDLPLMENIKVA
EVDAYEALPLQIDLILLAQYRAASSRSQREPQKIGERALRSMQLKRCHFARRQQLSDLAK
FEEAMNCVEKPSPPIRVENNVDLDTIDSSFTYIQKNIICEGVPQPEDGLVGCKCLDENGV
EECTASTKCCARMAGELFAYERSTRRLRLRPGSAIYECNSRCACDATCSNRLVQHGRQVP
LVLFKTSNGSGWGVKTPQALRKGEFVCEYIGEIITSDEANERGKAYDDRGRTYLFDLDYN
TAQESEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEEL
SFDYIRADNEDLPYENLSTAVRVECRCGAENCRKVLF
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctgaagctcaaatcggtgttaacagaaacctgcagaagcaggatctcagc
aacttggagattggcaacttaacgcccctctcaccggaggtgatctcgcggcaggccacc
atcaacattggcaccatcggtcatgtagcccacggtaaatcgacggtggtgaaggccatc
tcgggcgtacaaacggtgcgttttaaaaacgagctggagcggaacatcacaatcaagctc
gaacgcttaagcgaaaagaaaatccaaaaattgttgaaatcaaagcactaccgccagcag
tacgatatccagcagctatcacgtctgcggcacctagccgagagacgacgccacagccgc
ctgcgacgcctctgctccatgccagcccccccaccaggccacgccaccgacaaaaggacg
aatcgtcgcagcagcagccaaacctctctcagtccgagccacagcagcggctatggtagt
gccattggatgcgaagaccacgacaccacacactcgtcacacaaaggatcctccgtctcc
tccactagcctgaagcgtcgtcgcagtagtggggcccagtacacctcaacagcaagcgcc
aagagatcgaagaacaatcagggactggtggtgaagaagccaccgaaaggcgaatatgtt
gtcgagcgcatcgaagtagtcgaggtggttcagttcaagccggttttctttgttaaatgg
ctcggctacgatgccagcaacaacacgtgggaaagttacgagaatgttgcagattgcgct
caactcgaggagtttgtggaccggcagctccagctctacgagaagtacattgcccagata
accagcgaactggaggagcagctggaggacttaccgttgatggaaaacataaaggtggcc
gaggtggatgcctacgaagccctgccactccagatagacctaatccttttggcccagtac
agggcggcaagtagtaggagccaaagggagccgcagaagatcggcgaacgggctctccga
tctatgcagctcaagaggtgtcattttgcgcgtcgccagcagctatctgatctcgccaag
ttcgaggaggcaatgaactgtgtggagaagccatcgccgcccatccgagtcgagaataat
gtcgatctggacaccatagacagcagctttacttacattcaaaagaacatcatttgcgag
ggtgtgccccagccggaggacggtctggtggggtgcaagtgcctggatgagaacggagtg
gaagagtgtaccgcgtccacaaagtgctgtgcccgcatggccggtgaactcttcgcctac
gaacggagcacacgacgcctccgattgcgtcctggaagtgccatatacgagtgcaatagc
cgatgcgcctgcgacgccacttgctccaaccggctggtgcagcacggacgccaggtacct
ctggtgttgttcaagactagcaacggcagcggatggggcgtgaaaactccgcaagctctg
cgcaagggagaatttgtctgcgagtacatcggcgagataatcaccagcgacgaggccaat
gagcggggcaaggcctacgacgaccggggacggacgtatctcttcgacttggactacaat
accgcgcaggaaagcgagtacacaatcgatgcggccaattatggcaacatatcgcacttt
atcaaccactcgtgtgaccccaatctggcggtctttccctgctggatcgagcatttaaat
gtggcgctgccccacctcgtcttcttcactctgcgaccgatcaaggctggcgaggagctg
agcttcgactacatccgtgcggataacgaggacctgccctatgagaacctatcgacggcg
gtgcgggtcgagtgtcgttgcggggcagaaaattgtcggaaggtcctgttttag

DBGET integrated database retrieval system