KEGG   Drosophila ananassae: Dana_GF12162Help
Entry
Dana_GF12162      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dan  Drosophila ananassae
Pathway
dan00480  Glutathione metabolism
dan00980  Metabolism of xenobiotics by cytochrome P450
dan00982  Drug metabolism - cytochrome P450
dan00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dana_GF12162
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dana_GF12162
   00982 Drug metabolism - cytochrome P450
    Dana_GF12162
   00983 Drug metabolism - other enzymes
    Dana_GF12162
Enzymes [BR:dan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dana_GF12162
Transporters [BR:dan02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dana_GF12162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin DUF3431
Motif
Other DBs
NCBI-GeneID: 6495018
NCBI-ProteinID: XP_001959216
FlyBase: FBgn0089201
UniProt: B3MBB3
LinkDB All DBs
Position
Unknown
AA seq 216 aa AA seqDB search
MSGLVLYGLDISPPVRACKLVLRALDLDYQYKQVDVLAGEHFKEEFKKKNPQNTVPLLED
NGALIWDSHAIVCYLVDKYAKTDELYPKDLLARAQVNQRLYFDASVLFMSLRNVSIPYFY
HNVTLVPKEKVDNIKSGYAILESFLGDNPYVTGSTLTVADLCCGATASSLAAILELDATK
YPKVAAWLERLSKLPDYEGGLKEYIELLRPVLTLEH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcttggtgctatacggtttggacataagtccaccagtcagggcctgcaagttg
gtcctgcgagctctggacttggactatcagtacaagcaggtcgatgtgttggctggggag
cacttcaaggaggagtttaagaaaaagaatccccagaacacagtgcccctgttggaagat
aatggagctctcatctgggactcgcatgccattgtctgttatttggtggacaagtatgcc
aagacggatgagctgtatcccaaggatctgctggcacgggcccaggtgaatcagcgactc
tacttcgatgccagtgtcctgtttatgtccttgcggaacgtcagtattccctatttctac
cacaatgtgactctagtgcccaaggaaaaggtggacaacatcaagtcgggctatgccatc
ctggagtcctttttgggggacaatccctatgtcactgggtccaccctgactgtggcggat
ctgtgctgtggagccactgcctcctcgttggccgccattctcgagctggacgccaccaag
tatcccaaggtggccgcctggctggagcgcctctccaagttgcccgactacgaggggggc
ttgaaggagtacattgagctgctccggcccgttctgaccttggagcattga

DBGET integrated database retrieval system