KEGG   Desulfobacca acetoxidans: Desac_1710Help
Entry
Desac_1710        CDS       T01454                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dao  Desulfobacca acetoxidans
Brite
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Desac_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1910175..1910825
Genome map
AA seq 216 aa AA seqDB search
MPITMKSVLAFLTILTLFVVTTAAAAPVTYQAKDFSRLRGMKGFSDQALELHFVLYQGYV
KNTNAMLETLAQIASSTPAYAEMKRRLGWEYNGMRLHELYFGNLGGDGKIPPDSKIAKRL
TEQFGSLESWANDFKATGAMRGIGWVVLYEDQASGRLINTWINEHDLGHLAGGQPLLVMD
VFEHAFIPDYGLKKGDYIEAFFQNIDWKAVDARLGK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaccatgaagtctgtcttggcctttttgacgatcctaacactttttgttgtt
acaaccgcggcggctgccccagtcacctatcaggccaaagattttagccgcttaaggggt
atgaaggggtttagtgaccaggccctggaactgcatttcgtcctctatcagggttatgtg
aaaaacactaacgccatgcttgaaaccttggcgcaaatcgcctccagcacgccggcctat
gctgaaatgaagcggcgtctgggttgggagtacaacggcatgcgcctccatgaactctac
ttcggcaatctggggggagacggcaagattcctccggatagcaagatcgccaagcgtttg
accgagcagtttggcagcctggagagctgggccaacgacttcaaagctaccggcgccatg
cggggcatcggttgggtggtgctgtatgaagaccaggccagcggccgtttaatcaatacc
tggatcaatgaacatgatctcggccacctggctgggggccagcccctcctggtcatggat
gtctttgagcatgcctttattccggactacggtttaaaaaaaggcgattatattgaagcc
ttttttcaaaatattgattggaaagccgtggatgcgaggttgggtaagtag

DBGET integrated database retrieval system