KEGG   Dechloromonas aromatica: Daro_1921Help
Entry
Daro_1921         CDS       T00259                                 

Definition
(GenBank) Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal:FAD dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dar  Dechloromonas aromatica
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Daro_1921
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Daro_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2065308..2066882)
Genome map
AA seq 524 aa AA seqDB search
MINAPLKREDGLAKLRDTAPWDVLIIGGGASGLGAAVDAAARGYRTLLIEARDFASGTSS
CSTKLIHGGVRYLRQGDIGLVRNALHERSHLLRNAAHLVHPLAFIIPAWRNIDRVFYGAG
LKLYDLLAGRQGLAASRSLNRQDVIDALPGLRRASLCGGIRYWDGQFDDARLAITLMRTA
TDLGASCLNYLPVTRLIKTGGRVAGAVLCDAESGEEFEVRARAVINATGVHADSVRRFDD
SAAVPLLTPSQGIHLVVDADFLPGQQAILVPKTEDGRVMFAIPWQGKVLLGTTDTPRPEL
SQLDDPQPLDEEIDFLLRTAASVLSRPPTRSDIRSAFAGLRPLIHPDNKDGKSTAALSRE
HAVLVSTSGLITVAGGKWTTYRLMAEQVIDRTIEVAGLPAVPCPTRTLKLHACPAQPGND
VYGTEAPLLATLPGHDQPLHPELPYNAAMVRFAIRYEMARTIEDVLARRTRALFHDAAAA
EKMIDRIAGIFAEELQLTEERLASLIEAAHESARRFMAAQNSGA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgcaccgctcaagcgcgaagacggcctcgccaagctgcgcgacactgcccct
tgggatgtactgatcatcggcggtggcgccagcggcctgggcgcagccgtcgacgccgcg
gcacgcggttaccgcaccctgctcatcgaggcccgcgacttcgcgtccggaacctcatcg
tgcagcaccaagctgattcacggcggcgttcgttacctgcgccagggcgacatcgggctg
gtccgcaatgccctgcacgaacgctcgcacctgcttcgcaatgccgcccatctggtgcat
ccgctggctttcatcatcccagcctggcgaaacatcgaccgcgttttttacggcgccggc
ctgaagctttatgacctgctggccggccggcaggggctggctgcctcgcgcagcctgaac
cgccaggacgtgatcgacgccctgcccggcctgcggcgcgccagcttatgcggcggtatt
cgctactgggacggccagttcgatgatgcgcggctggccatcacgttgatgcgcacggcc
actgatctcggcgcaagctgcctcaactacctgccggtcacccggttgatcaagaccggc
ggccgcgttgccggtgccgtgctgtgtgacgcggaaagcggcgaggaattcgaagtccgc
gcccgtgccgtgatcaacgccaccggagtgcatgccgacagcgtgcggcgtttcgatgac
agcgctgccgtgccgctgctgaccccaagccagggcatccatctcgtcgtcgatgccgat
ttcctgcccggccagcaggcaattctggtcccaaaaaccgaagacggccgcgtcatgttc
gccattccctggcaaggcaaggtactgcttggcaccaccgatacgccgcgccccgaacta
agccagctcgacgacccgcaaccgctggacgaggagatcgacttcctgctgcgtaccgcc
gccagcgtcctcagccgcccacccacgcgatccgatatccgcagtgcctttgccggcctg
cgcccgctgatccacccggacaacaaggatggcaagagcaccgccgccctgtcgcgcgaa
cacgccgtgttggtcagcaccagcggactgatcaccgtcgctggcggcaagtggacgacc
taccggctgatggccgagcaggtgatcgaccgcaccatcgaggtcgccggcctgcccgcc
gtgccatgcccgacccgaacactgaaactgcacgcttgcccggcccagccaggcaacgat
gtttatggcaccgaggcaccgctgctcgccacgctgcctggccacgaccagccgctccac
ccagaactgccttacaacgcagcgatggtgcgcttcgccatccgctacgaaatggctcgg
acgattgaagacgtgctggcccgccggacacgtgccctgtttcacgatgcggcggcagcc
gaaaaaatgatcgaccgcatcgccgggatattcgccgaggaactccagttgaccgaagaa
cgtttggccagcttgatcgaagccgcccatgaaagtgcacggcgtttcatggcggcgcag
aactccggcgcctga

DBGET integrated database retrieval system