KEGG   Candidatus Desulforudis audaxviator: Daud_0851Help
Entry
Daud_0851         CDS       T00655                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00500  Starch and sucrose metabolism
dau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Daud_0851
Enzymes [BR:dau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Daud_0851
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Daud_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 EcKinase Cyc-maltodext_C Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ACA59364
UniProt: B1I2Z5
LinkDB All DBs
Position
complement(898759..902085)
Genome map
AA seq 1108 aa AA seqDB search
MLDQNPLWYKDAILYELHVRAFFDRNGDGIGDFRGLAEKLDYLQDLGVTAIWLLPFYPSP
LKDDGYDIADYTAVHPSYGTLADFKFFVREAHRRGLRVVTELVCNHTSDQHPWFQRARRA
KAGSVWRNFYVWSDTPEKYREARIIFKDFETSNWTWDPAAGAYYWHRFYAHQPDLNYDNP
MVRKAIFKVLDFWLRIGVDGLRLDAVPYLYERDGTNCENLPETHAFLKELRRHVDERFQN
RMLLAEANQWPEHAAAYLGDECHMAFHFPLMPRLFMALRMEDRFPVVDILTQTPPISETS
QWALFLRNHDELTLEMVTDEERDYMYRAYAHDPRMRINLGIRRRLAPLLGNHRRRIELMN
GLLFSLPGTPVIYYGDEIGMGDNIYLGDRNGVRTPMQWSADRNAGFSKADRQRLYLPVIV
DAEYHYETVNVETLQNNPHSLLSWMKRLISLRKRYKAFGRGSLEFLHPENRKVLAYVRRY
EDESILVIANLSRFAQCVELDLNAYRGMIPVEMFGRTEFPPVGDRPYFFTLGPHAFFWFS
LEPQRLLWERSPGGAPRAGIPTLVLKGSWEAAFWGGDRDALAEVLPFYLANCRWFGGKAR
RLNSTRVTEVIPVPYNGSVAYITLVQADYTEGDPETYILPLALATGEWGRVWEGGRELVQ
SAVARLQTKDKTGILYDALWDPAFCEVLLDAVPRRRRFKGESGTMIATPTRQFARLRGPV
QAPVEPVLIQAEQSNSTVLFGDRLMLKLFRRAGEGINPDLEISRFLAEQSTFTQVAPLAG
SLEYFREKDRPVTLAVLQGFVPNKGDAWQYTLGALSRFFGRVRRASGLKVPPLPSKILFA
QTGEDLSPATKMIGGYMDKARLLGRRTAELHLALAARPDNPDFAPEPFTTFYQRSLYQSM
RSLTSQVFLTLRRKLAELPEAARAEAQAVLDLEGEVLNRFQTLLTHKIDTVRTRCHGDYH
LGQLLYTGEDFVIIDFDGEPARPVQESPAKRTPLRDVAGMLRSFHYAAYTALYNQTGTDG
PPRGEDRAVLEPWARFWHLKVSAAFLDSYFQTAGRASFLPETPEQLSVLLDACLLEKAVY
ELGYELNNRPEWVPIPLKGILELLQVRA
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaccaaaatccgctctggtataaggacgccatcctgtacgagcttcacgtgcgg
gccttttttgaccgcaacggcgacggcatcggtgacttccgcggtctggccgaaaagctt
gattacctccaggatctgggggtgaccgcgatctggctgctgcctttctacccttccccc
ctgaaggacgacggctacgatatcgccgactacacggccgtccatccgtcctacgggacg
cttgcggacttcaagtttttcgtccgggaagcccaccgccgggggttgcgcgtggtcacc
gaactggtgtgcaaccacacctcggaccagcacccctggttccagcgcgcccggcgggcg
aaggcgggcagcgtgtggcggaatttctacgtctggagcgacaccccggagaagtaccgg
gaagcgcgaatcatcttcaaggatttcgagacttcaaactggacttgggatccggcggcc
ggcgcctattactggcaccggttctacgcgcaccagccggacctgaactatgacaacccc
atggtccggaaagccattttcaaggtgctcgacttttggctgcggatcggggtggacggg
ctgcgcctggatgcggtgccctacctgtacgagcgggacggcacaaactgcgagaacctg
ccggaaacccacgcctttttgaaagagttgcgccgccacgttgacgaacgcttccagaac
cgcatgctcctggccgaagccaaccagtggcccgagcacgccgctgcctacctgggagac
gagtgccatatggccttccattttccgctgatgccgcgcctattcatggcgctgcgcatg
gaggaccgctttccggtcgtcgacattctgacgcaaacgcccccgatctcggaaacctcc
cagtgggcgcttttcctgcgtaaccacgatgagctgaccctggaaatggtcaccgacgag
gagcgggactacatgtaccgcgcgtacgcgcacgacccccggatgaggatcaacctcggc
atccgccggcgtctggccccgttgcttggaaaccaccgccggcgcatcgagctgatgaac
ggccttctcttttccctgccgggaaccccggtgatttactacggggacgaaatcggcatg
ggcgacaacatctacctgggcgaccgcaacggtgtgcgcacgccgatgcagtggagcgcc
gaccgcaacgcggggttttccaaggccgaccgccagcggctgtacctgcccgttatcgtc
gatgccgagtatcattacgaaacggtcaacgtcgagacacttcagaacaaccctcattcc
ctgttgtcgtggatgaaacggctgatctcgctgcggaagcgctacaaagctttcgggcgc
ggcagcctggagttcctgcatcccgaaaaccgcaaagtgctggcctatgttcgccgttac
gaggacgagtcgatcctggtcatcgccaacctctcccgtttcgcgcagtgtgtcgagctt
gacctgaacgcttaccgcggtatgatcccagtcgaaatgttcggccgtacagagtttcct
ccggtaggggaccggccgtactttttcaccctcggcccacacgcctttttctggttttcc
ctggaaccccagcgtctcctttgggaacggagcccgggcggcgcccccagggcgggcatt
ccgaccctggtgttaaaaggctcctgggaagctgccttttggggcggcgaccgggacgcc
ctggcggaggtcctgccgttctatcttgccaactgccgctggttcgggggcaaggcccgg
aggctgaattccacccgggttacggaggtcatccccgtgccgtacaacggttcggtggct
tacatcaccttggttcaggccgactataccgaaggggaccccgagacctatatcctcccc
ctcgctctggccacaggagagtgggggcgggtgtgggaggggggccgcgaactggtccag
tcggccgtggcccggctgcaaacaaaggataagacaggcatcctgtacgacgccctgtgg
gaccccgccttctgtgaggtcttgctggatgccgtcccccgccggcgccgcttcaaaggg
gaatccggcactatgatcgccacgccgacgcgacaattcgcccggctgcgcggtccggta
caggcgccggtggaaccggtgctcatacaggcggaacaaagcaacagtacagtgctgttc
ggggaccggctgatgttgaagctcttccggcgtgccggggaaggcattaaccccgatctc
gaaatcagccgtttcctggccgagcaatccacctttacccaggtcgcccccctggccggc
agtctggagtattttcgggaaaaggaccggccggtgactctggccgtgctgcagggtttc
gtgccgaacaagggggacgcctggcagtacacgctgggcgcgctgtctcgtttctttgga
agggtccggcgggcgtccggtctgaaagtgccgccgctcccgtccaaaatcctgttcgct
cagaccggggaggacctctccccggcgaccaaaatgatcggtggttatatggacaaggcc
cggctgctcggccggcgcacggcagagcttcacctggcccttgccgcccgtccggataac
ccagacttcgcccccgaaccgttcaccacattttaccagcggtccctgtaccagtccatg
cgcagcctgaccagccaggtcttcctgactctacgccgcaagctggcggagttgccggaa
gcggcgcgcgcggaagcccaggccgttctagaccttgagggggaagtcttaaaccgcttc
cagaccctgctcacccacaagatcgacaccgtgcgcacccgctgtcacggcgactaccac
ctcggccagttgctttacaccggcgaggatttcgtgatcatcgacttcgacggcgaaccg
gcccgtccggtacaggagtcgccggccaaacgcacgcccttgcgcgacgtagcaggcatg
ctccgctccttccactacgctgcctacaccgcgctgtacaaccagacgggcacagacggg
ccgccccgcggggaagaccgggccgtcctggagccgtgggcccgtttctggcacctgaag
gtctccgccgcctttctggactcctatttccagactgccggccgggcctccttcctgccg
gagacgcccgagcagttgtccgtcctgctggacgcctgcctgctggaaaaggccgtgtac
gaactggggtacgaattgaacaaccgcccggaatgggtgccgattccgctgaagggaatc
ctggagttgctccaggtccgggcgtga

DBGET integrated database retrieval system