KEGG   Desulfotomaculum nigrificans: Desca_0196Help
Entry
Desca_0196        CDS       T01498                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
dca  Desulfotomaculum nigrificans
Brite
Translation factors [BR:dca03012]
 Eukaryotic Type
  Elongation factors
   Desca_0196
 Prokaryotic Type
   Desca_0196
Mitochondrial biogenesis [BR:dca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Desca_0196
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Desca_0196
  Exosomal proteins of breast cancer cells
   Desca_0196
  Exosomal proteins of colorectal cancer cells
   Desca_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
215469..216671
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITVVLSTTGGATVKRYDEIDNAPEERERG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIIVFLNKADMVDDPELLELVEMEVRELLSSYEFPGDDTPIVAGSALKALE
CGCGKRECEWCGKIWELMDNVDSYIPTPERAVDKPFLMPVEDVFSITGRGTVATGRVERG
QVKVQDEVEIVGLADKPRKTVVTGVEMFRKLLDFAQAGDNIGTLLRGVDRKEIERGQVLA
KPGSIHPHTKFDAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVIHLPEGVEMVMPG
DNIKISIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIRE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgaacgtactaaaccccacgtaaacattggtaccattggtcac
gttgaccacggtaaaaccactttgaccgctgctattaccgtagttctgtccaccaccggt
ggtgctaccgttaagcgttatgacgagattgataacgctcccgaagaacgtgagcgcggt
attaccattaacaccgcccacgtagaatacgaaaccgccaaccgtcactatgctcacgtt
gactgccccggacacgctgactatgttaaaaacatgatcaccggtgctgctcaaatggat
ggagccattctggttgtatccgctgctgacggccccatgccgcagacccgtgagcacatc
ctgctgtcccgtcaggtaggtgttccttacatcatcgtattcctgaacaaagcagatatg
gttgacgatcctgagctgcttgaactggtggaaatggaagttcgtgaactgctgagctcc
tatgaattccccggcgatgacacccccatcgtagccggttccgctctgaaagcgctggag
tgcggctgcggtaagcgtgagtgcgaatggtgcggtaagatttgggaactgatggacaat
gtagactcctacattcctactcccgagcgtgccgtagataagccgttcctgatgccggta
gaagacgtattctccatcaccggtcgtggtaccgtagccaccggtcgtgtagaacgcggt
caagttaaagtacaagacgaagtagagatcgtaggtctggctgacaaaccgcgtaagacc
gtagtaaccggtgtagaaatgttccgtaagctgttagactttgcccaagccggtgacaac
atcggaaccctgctgcgcggtgtagaccgtaaagaaatcgagcgtggtcaagtactggct
aagcccggcagcattcatccgcacaccaaatttgatgctgaagtatacgtactgaccaaa
gaagaaggaggacgtcacactccgttctttaacggctatcgtccccaattctacttccgt
accaccgacgtaaccggtgttatccacctgccggaaggcgtagaaatggttatgcctggt
gacaacattaagatttctatcgacctgattacccccatcgccattgaggaaggcttacgc
tttgctattcgtgaaggtggccgtaccgttggtgctggtgtggtaaccggtatccgcgaa
taa

DBGET integrated database retrieval system