KEGG   Dendrobium officinale: 110093044Help
Entry
110093044         CDS       T05027                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dct  Dendrobium officinale
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dct00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110093044
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110093044
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110093044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 168 aa AA seqDB search
MSARFLIATQIPSYAGLRPEPSHKLSSAKASVQWQARRRVSNGSRVHCMKTWDPINNKRY
EVLSYLPPLSAESIAKEVDYMISKGWIPCLEFDEVGKIHRSNSNVPGYYDGRYWTLWKLP
MFGCTDSSQVLHEIDECRKAYPDAYIRLLSFDNVRQCQCMSFVIQKPT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagattccttattgcaacgcaaatcccaagctatgccgggctcaggcctgaa
ccatcccacaagctaagctctgcaaaagctagtgttcagtggcaagcaagaagaagagtc
tccaatggctcaagagttcattgcatgaagacatgggatcccataaacaacaaaaggtat
gaggtattatcctatttacctcccctctcagctgaatcaattgcaaaggaagttgattat
atgatctcaaagggatggattccttgcttggaattcgatgaggttgggaaaatacataga
agcaactctaacgtcccaggctactatgacggcaggtattggacactgtggaagttgcct
atgtttgggtgcactgattcctctcaagtgctacatgagattgatgagtgtagaaaggca
tatcctgatgcatacatacgtcttctttcctttgacaatgtgcggcagtgtcagtgcatg
tcctttgttatccagaagcctacctaa

DBGET integrated database retrieval system